KEGG   Megasphaera elsdenii: MELS_1970Help
Entry
MELS_1970         CDS       T01633                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
med  Megasphaera elsdenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MELS_1970
Enzymes [BR:med01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MELS_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161706..2165104)
Genome map
AA seq 1132 aa AA seqDB search
MDLRLYHNSHEFYYRSSFGAVPSGSRLILRLRAGGSDARNCRARIRLWQSNVGESFVPMT
YQDGIFTGCVTMPPKGCLVWYYFIVDDGHETVYYGNNYDRLGGEGAKYPEVPPAYQVTVY
DKDAHTPDWFKHAIVYQIFPDRFRHGTHTTGRLYGKKGAVIHSDWDDVPYYCKREGQGDI
VYYDFFGGNLAGIREKLPYLKELGITAIYLNPIFESSSNHRYGTADYFRVDPMLGTNEEF
AAFCQAAKEAGIHIILDGVFSHTGADSIYFNRFGNYPGVGAYQSKESPYYEWYRFKQYPD
DYESWWGVSDLPDVEETTPSYMDFIIDSEDSVLKYWLNEGISGWRLDVIDELPVPFLRQF
YHTLKEEKPDAILIGEVWEDASNKVSYSEQREYLCGYDIDSAMNYAQRAIMLDFMTGVKD
ARRMNAELTRLIENYPPENFYAMLNLIGSHDIERILTVLTKAGGTDVATAEETGKKRLKL
LTAWQMTMPGAPCIYYGDEVGVTGGKDPDNRRTYPWGHEDLDLLSWTKALTRLRTAHDAL
QTGRFIPLYADGDVFAFARVIEGGQDVFGKPAEDGFFIIAMNRNPSALRTISIYTDGLAY
GKLTNALHPRMTPVTTVNSRLTLTLPPLKVVILQGKEAGTKRAGVLLHPTSLPAACGNGV
LGPAAYRFVDFLKAAGQRVWQILPLTPPLMGDSPYLSESAFAGNEALISLEVLRDWGWLR
QEALDDFLAQGQKTTSWHSLAAYKAKILWDMSHDPDLTIPWEPFRAFCEKNAYWLDDYAL
FRAVRDFFGGRCWTEWPEDIRHHSREALAQYGRELAGAVSHVKFMQYIFSRQWHDVRAYA
AKNGVSVLGDVPMFVAHNSADCWAHQDQFDLDEMGNPSSVAGVPPDYFSADGQLWGNPLY
DYQAMAADNYQWWTDRFRRMMDLVDEVRVDHFRGFAAYWAVPAGSETAKSGAWKEGPGLD
LFRAVYQKIGRLRLVAEDLGVITDDVCTLKDALHLPGMKVIQFHLKDRADGRLAFDTEPD
CIAYTGTHDNNTIRGWYEDDLSPSQQLHVRQMLGLSDEAAPQEIVGALIAYTCRRRAETV
IIPMQDLLALPSSGRMNTPGVAEGNWHWQLKDGQLTFDIARWLAKVCRESGR
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggacttacgattgtaccacaactctcatgaattttattaccgctcgtcttttggtgcc
gttccctccgggagccggctcatcctgcgcctccgggccggcggcagcgatgcccggaac
tgccgggcccgcatccgcctgtggcagagcaatgtcggtgaatcctttgtgcccatgacg
taccaagacggcattttcacgggctgcgtcaccatgccgcccaagggctgcctggtctgg
tattatttcatcgtcgacgatggccatgagaccgtctattacggcaataactacgatcgc
ctcggcggggaaggggccaaatatcccgaggtgccgccggcctatcaggtcacggtctac
gataaggacgcccatacgccggactggttcaaacatgccatcgtctaccagattttcccg
gaccgcttccgccacgggacccatacgacaggccgcctgtacggtaagaaaggggccgtc
atccatagcgactgggacgacgtgccttattactgcaagcgcgaaggccagggcgacatc
gtctattacgacttttttggcggcaacctcgccggtatccgggaaaagctgccttacttg
aaggaactgggaatcacggcgatttacctcaacccgatttttgaaagttccagcaatcac
cgctacggtacggccgattacttccgcgtcgaccccatgctggggacgaatgaagaattt
gccgctttctgccaggccgccaaagaagcaggcatccacatcatccttgacggcgtcttc
agccataccggggccgacagcatttacttcaaccgcttcggcaactatcccggcgtcggc
gcctatcagtcgaaggaatcgccgtattatgaatggtaccgcttcaagcagtatcccgac
gactatgaatcgtggtggggcgtatcggacctgcccgatgtcgaagagacgacgccgtct
tatatggatttcatcatcgacagcgaagacagcgtcctcaaatactggctgaacgaaggc
atcagcggctggcgcctggacgtcatcgacgaactgcccgtgcccttcctgcgccagttc
taccatacgctgaaagaggaaaagcccgacgccatcctcatcggcgaagtctgggaagat
gcttcgaacaaggtcagttacagcgagcagcgggagtacctctgcggctatgacatcgac
agtgccatgaattacgcccaacgggccatcatgctggatttcatgaccggtgtcaaagat
gcgcggcgcatgaatgctgaattgacgcggctcattgaaaattatccgcccgaaaatttc
tatgccatgctcaacctcatcggcagccacgatatcgaacgcatcctgacggtcctcacc
aaggccggcggcaccgacgtggcgacggccgaagaaacgggcaagaagcgcctgaagctg
ttgacggcctggcagatgaccatgcccggtgcgccctgcatctattacggcgatgaagtc
ggcgtcaccggcggcaaggatcccgacaaccgccggacctatccctggggccacgaagac
ctggacctgctgtcctggaccaaggccctgacgcggctgcgcacagcacacgacgcttta
cagacgggccgcttcatccccctctatgccgacggcgacgtcttcgcctttgcccgggtc
atcgaagggggacaggatgtcttcggcaagcccgccgaagatggcttcttcatcatcgcc
atgaaccgcaatccgtcggccctgcggacaatcagtatctatacggacggcctggcttac
gggaaactgaccaatgccctccatccgcgcatgacgccggtcacgacggtgaacagccgc
ctgaccctgaccctgccgcccctgaaagtagtcatcctccaggggaaggaggccgggacc
aagcgggccggtgtcctcctgcatccgacgtccctgccggcagcctgtggcaacggcgtc
ttgggaccggcggcataccgcttcgtcgatttcctcaaagccgccggccaacgggtctgg
cagatcctgcccctgacgccgcccctcatgggcgattcgccgtatttgtcggaatcggcc
tttgccggcaacgaagccctcatttccctggaagtcctgcgcgactggggctggctgcgg
caggaagcgctggacgatttcctggcccaggggcaaaagacgacgtcctggcacagcctg
gcagcttataaggccaagattctctgggatatgtcccatgatccggacctgaccattccc
tgggaaccgttccgggctttctgtgaaaagaacgcctactggctcgacgactacgccctg
ttccgggctgtccgcgacttcttcggcggccgctgctggacggagtggcccgaagatatc
cgccatcacagccgggaagccctggctcagtacggcagggaactggccggcgccgtatcg
catgtcaaattcatgcagtatatcttcagccgccagtggcacgatgtccgggcctatgcc
gccaaaaacggcgtgtccgtcctcggcgatgtgcccatgttcgtcgcccacaacagtgcc
gactgctgggcccaccaggaccagttcgacctcgacgaaatgggaaatccgtcatctgtc
gccggcgtcccgcccgattacttcagtgccgatggccagctctggggcaatcccctttac
gattaccaggccatggctgcggacaactaccagtggtggacggaccgcttccgccgcatg
atggacctcgtcgacgaagtccgggtcgaccatttccgcggctttgccgcctactgggcg
gtgccggccggctcggaaacggctaagagcggcgcctggaaagagggccccggcctcgac
cttttccgggcggtctatcagaaaatcggcaggctccgcctcgtcgccgaagacctgggc
gtcattaccgacgacgtgtgcaccttgaaagatgccctgcacctgccggggatgaaagtc
atccagttccacctcaaggaccgggccgacggccgcctggccttcgatacggaaccggac
tgcatcgcctataccgggacccatgacaacaacaccatccgcggctggtatgaagacgac
ctgtcgccgagccagcagctccacgtccgccagatgctgggcctgtctgatgaagcggct
ccgcaggaaatcgtcggcgccctcatcgcctatacctgccgccgccgggccgaaacggtc
atcatccccatgcaggatctcctggccctgccgtcgtcgggacgcatgaatacgcccggc
gtggcggaaggcaactggcactggcagctcaaagacgggcagctgaccttcgatatcgcc
cgctggctggccaaagtgtgccgcgaaagcggacgttga

DBGET integrated database retrieval system