KEGG   Megasphaera elsdenii: MELS_1972Help
Entry
MELS_1972         CDS       T01633                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
med  Megasphaera elsdenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:med00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MELS_1972
Enzymes [BR:med01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MELS_1972
Exosome [BR:med04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MELS_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2166749..2168857)
Genome map
AA seq 702 aa AA seqDB search
MKLSAIDEYSTFLYHQGTNYASYRLFGAHFTVLRRKPCVRFAVWAPHAQQVSVVGDFNHW
DADANPMERSSCGNGIWVTHIAGLQEGDIYKYAITTASGERILKSDPYAFWSEVRPNTAS
KLTKLHYAWRDKKWMDSRSAYDSYRKPMLTYEVHLGSWRRDEDGEMLSYRDIAPQLVDYV
KQMNYTHIELMPLCEYPFDGSWGYQGTGYFSATSRYGKPEDLMYLVDLCHRNGIGVILDW
VPGHFCRDAHGLRHFDGDPCYESGNPMLAENKEWDTMNFDYGRTEVQSFLISSALFWLSQ
FHIDGLRIDAVANMLYLDYGHADGDWQPNKYGGRENLEAIEFLRHLNTAVFKEYPQALMI
AEESSAWPLVTKPVDVGGLGFNYKWNMGWMNDMLRYMSLDPLFRKDNHNLITFSLCYAFS
ENFILPLSHDEVVHGKHSLLDKMPGDYWQKFAGLRAFYGYWMSHPGKKLLFMGSEFGQFI
EWKYDDSLDWHLLKYPMHQAMHDYVRSLNTYYVDHPELWEEDCDWSGFSWISCDDCDNSV
IAFYRTGKDESDMTVVVCNFTPVVRHSYRFGVPRKGTYVEVFNSDATAFGGSNVLNEGEF
EAQDVPMHGMDQSLELTLPPLATIYLQLTGSAKKKAVTKRRRRRTVKTDKAADGTVKKTA
KAPGKKATTRGKGKAKTAASEKKTAATRKRRPGRPAKKEADV
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcagtgcaatcgacgagtacagtaccttcttgtatcatcaaggtacgaactac
gccagttatcgtctgtttggggcccatttcacggtcctgcgccgcaagccttgtgtgcgc
tttgccgtctgggcacctcatgcgcagcaggtcagcgtcgtcggtgatttcaatcactgg
gatgctgatgccaaccccatggaacggagcagctgcggcaatggcatttgggttacacat
attgccggcctccaggaaggggacatctacaaatacgccatcacgacggcatcgggggaa
cgcatcttaaagagcgatccttacgccttctggtcggaagtacgtcccaatacggcatcg
aaattgacgaaactccactatgcgtggcgcgacaagaaatggatggacagccgcagtgct
tacgattcgtaccgcaagcccatgctgacctatgaagtccatctcggctcgtggcgccgc
gatgaagatggggaaatgctgtcgtaccgcgacatagcgccccagctcgtcgattatgtc
aaacagatgaattatacccacatcgagctcatgccgctgtgcgaatatcccttcgacggc
tcctggggctatcaggggacgggctatttctcggcgaccagccgctatggcaagccggaa
gatttgatgtatctcgtcgacctgtgccaccgcaacggcatcggcgtcatcctcgactgg
gtaccgggtcatttttgccgcgacgctcacggcctgcgccattttgacggcgatccgtgc
tatgaatcgggcaaccccatgctggctgaaaataaggaatgggacacgatgaatttcgac
tatggccggacggaagtccagtccttcctcatttccagtgccctcttctggctcagccag
ttccacatcgacggcctgcgcatcgacgccgtcgccaacatgctctacctcgattacggc
catgctgacggcgactggcagcccaataaatacggcggccgggaaaacctggaagccatc
gaattcctgcgccatctcaatacggccgtcttcaaggaatacccccaggccctgatgatt
gccgaagaatcgtcggcctggcccctggtgaccaagcccgtcgacgtcggcggcctggga
ttcaattacaaatggaacatgggctggatgaacgatatgctccgctacatgtcgctggac
ccgctgttccgcaaggacaatcacaacctgattaccttttcgttatgttacgctttttca
gaaaacttcatcctgcctttgtcgcatgatgaagtcgtccacggcaaacattctctcctg
gacaagatgcctggcgactactggcagaaattcgccggcctgcgcgccttctacggctac
tggatgtcccatccgggcaagaagctcctgttcatgggcagcgagttcggccagttcatc
gaatggaaatacgatgacagcctggactggcacctcctcaagtatcccatgcaccaggcc
atgcacgactacgtgcgcagcctgaacacgtactatgtggaccatccggaattatgggaa
gaagactgcgactggtcgggcttctcgtggatcagctgcgacgactgcgacaacagcgtc
atcgccttttaccgtaccggtaaggacgaatcggatatgaccgtcgtcgtctgcaacttt
acgcctgtcgtccgccattcatatcgcttcggcgtcccccggaaagggacgtacgtcgaa
gtcttcaacagcgatgcgacggcctttggcgggtccaacgtcctcaacgaaggtgaattt
gaagcccaggatgtgcccatgcacggcatggaccagtccctggaactgaccctgccgccg
ctggcgacgatttacctgcagctcactggaagtgctaaaaaaaaagcagtgacgaaacgg
cggcgccgccggacggtgaaaaccgataaggccgctgacgggaccgtcaagaaaacggcc
aaggcgccgggaaagaaggcgacgacccgtggaaaagggaaagccaaaacggcagcgtct
gaaaagaagactgctgcaacgagaaagagaagacctgggcgtcctgccaaaaaggaagca
gacgtctga

DBGET integrated database retrieval system