KEGG   Methylotenera versatilis: M301_0042Help
Entry
M301_0042         CDS       T01247                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
meh  Methylotenera versatilis
Pathway
meh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M301_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Peptidase_M61
Motif
Other DBs
NCBI-ProteinID: ADI28430
UniProt: D7DK45
Position
complement(65553..65933)
Genome map
AA seq 126 aa AA seqDB search
MKSYTLLFLSFQVVEAIINVQTAYAGDAANGMRVFNTYCSDCHSITEGKNKIGPSLWNVV
GRKPASISDFNYSDAMRKNDIIWTEDRISTYITNPQGLLPGVKMAFPGLKDPQKCADVIQ
FLSQQH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttatacgttactatttttaagctttcaggttgtcgaagccatcattaatgtc
cagacagcctatgctggtgatgccgcaaatggtatgcgtgtatttaacacgtactgttca
gactgccacagtattacagagggcaaaaataaaattggtccctcactttggaatgtcgtg
ggaagaaagcctgccagcattagcgactttaactattcagatgctatgcgtaagaatgac
ataatatggacagaagatagaatctctacttatattacaaacccccagggattgctgcca
ggggtgaaaatggcttttccggggctaaaagacccgcaaaaatgtgctgatgtcatacag
tttttatcacagcagcactga

DBGET integrated database retrieval system