KEGG   Methylotenera versatilis: M301_0042Help
Entry
M301_0042         CDS       T01247                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
meh  Methylotenera versatilis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:meh00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:meh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(65553..65933)
Genome map
AA seq 126 aa AA seqDB search
MKSYTLLFLSFQVVEAIINVQTAYAGDAANGMRVFNTYCSDCHSITEGKNKIGPSLWNVV
GRKPASISDFNYSDAMRKNDIIWTEDRISTYITNPQGLLPGVKMAFPGLKDPQKCADVIQ
FLSQQH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttatacgttactatttttaagctttcaggttgtcgaagccatcattaatgtc
cagacagcctatgctggtgatgccgcaaatggtatgcgtgtatttaacacgtactgttca
gactgccacagtattacagagggcaaaaataaaattggtccctcactttggaatgtcgtg
ggaagaaagcctgccagcattagcgactttaactattcagatgctatgcgtaagaatgac
ataatatggacagaagatagaatctctacttatattacaaacccccagggattgctgcca
ggggtgaaaatggcttttccggggctaaaagacccgcaaaaatgtgctgatgtcatacag
tttttatcacagcagcactga

DBGET integrated database retrieval system