KEGG   Methylotenera versatilis: M301_0072Help
Entry
M301_0072         CDS       T01247                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
meh  Methylotenera versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:meh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(93518..94300)
Genome map
AA seq 260 aa AA seqDB search
MMADNVLKGLHVAVTRPVDQAESICEAIQHHGGDAISFPLLAISPLDDYHEFENVIADLE
QADWAIFISTNAVDNSLPRILKKFGNVPENLKFAAIGHQTAKELSLYGVHQVLIPHTRFD
SETLLALAEMHDVENKNIVIFRGVGGRDMLANTLKSRGANVTFAECYRRINPQTDAQFLN
SEWQQGHLNAVIVTSSEAMRNLLDIAGESEWLRRVTLCVNHARIAEQPLQLGFKVLVTEA
PGDDAMIKCLSQLALSQVAN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagataatgtactaaaaggtttgcacgttgcggtcacccggcctgtcgaccaa
gctgaaagtatctgtgaggcgattcaacaccatggcggtgatgcgatttcatttccattg
ctcgccatttcgcctttagacgattatcatgaatttgaaaatgtcattgccgaccttgag
caagctgactgggcaatctttattagcaccaatgcggttgataactcattaccgagaatt
ctcaaaaaatttggcaatgtgcctgaaaatctgaaatttgccgcaattggtcatcaaacc
gctaaagaactcagtttgtatggcgttcatcaagtgctgataccacacacacgttttgac
agcgaaaccttactggcacttgctgaaatgcacgatgttgagaataaaaatatcgtcatt
tttcgtggagttggcgggcgcgacatgttagcaaatacgcttaaatctcgcggcgcaaat
gtcacatttgccgaatgctaccgtcgcattaacccacaaactgacgcacaatttctgaat
agtgaatggcagcaaggtcatttaaatgccgtcatcgtgacgagcagtgaagccatgcgc
aatttgttagatatagcaggcgaatccgaatggctgcgccgcgtcacgctgtgtgttaat
catgcccgaatcgccgagcagccactgcagcttggttttaaagtattagtgactgaagca
ccaggcgatgatgcgatgattaaatgtttatctcagttggctttatctcaagtagcgaat
taa

DBGET integrated database retrieval system