KEGG   Methylotenera versatilis: M301_0300Help
Entry
M301_0300         CDS       T01247                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
meh  Methylotenera versatilis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:meh00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:meh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
340132..341394
Genome map
AA seq 420 aa AA seqDB search
MEKLIIQGGSRLNGEVTISGAKNAALPILCASLLAETPLHLSSIAALKDIDTTIKLLDMM
GVKITRNTSEVTLDASDVTSFEATYEMVKTMRASILVLGPLLARFGTARVSLPGGCAIGS
RPVDLHIKGLQAMGAAIHITHGYIQASTLHLPNRRLQGARYYMDMVTVTGTENLMMAAAL
AEGTTVLENAAKEPEVVDLAEMLIKMGAKITGAGTDVITIVGVEKLNGTTHNVVCDRIEA
GTYMVAAAMTGGEVKLLNARADLLDAVIEKLRDAGATVTSDANSITVKSDGKLKAVNIRT
APHPAFPTDMQAQFMALNVIAEGVSKVTETIFENRFMHVQEMQRMGADISIDGNTALVKG
IEFLDGATVMATDLRASASLVLAGLVARGETVIERIYHLDRGYEHLEAKLNALGANVKRV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagctaatcatacaaggcggtagtcgcctcaatggtgaagtcaccatctctggc
gcaaaaaatgccgctttgccaattttatgcgcatcactattagctgagacgccgttgcat
ttaagtagtattgcagcgctaaaagacatcgacacgactataaaactgctcgatatgatg
ggcgttaaaattacacgcaatactagcgaagtgactttagatgccagtgacgtgacttct
tttgaagccacttacgaaatggtgaaaaccatgcgtgcatcaattttggtgttaggtccg
ttattggcgcgctttggtactgcgcgtgtctcattgccgggcggatgtgcaattggttca
cgcccagttgatttgcacatcaaaggcttgcaagccatgggtgctgcgattcatattaca
catgggtatattcaagcgagtactttgcatttacctaatcgtcgtttgcaaggcgcgcgt
tactatatggacatggtcactgtgaccggtacggaaaatctcatgatggctgcggcatta
gcagaaggcacaaccgtgttggagaatgctgctaaagagcctgaggtggtcgacttagcg
gagatgctcattaaaatgggcgcaaaaatcacgggagctggtactgatgtcatcacgatt
gtaggcgttgagaagctgaatggcacaacacataacgttgtgtgtgaccgtatcgaagca
ggtacttatatggtagctgctgcgatgacaggtggcgaggttaagttactcaatgcgcgt
gctgacttgctagatgctgtcattgaaaaactgcgcgacgcgggtgcaactgtcacgagt
gatgcaaacagcattaccgtaaaaagtgatggtaagcttaaagcagtgaatatccgcaca
gcaccacacccagcttttccaacagatatgcaagcgcagtttatggcgcttaatgttata
gctgaaggcgtttcaaaagtgactgaaaccatttttgaaaatcgttttatgcacgtacaa
gaaatgcaacgtatgggcgcagatattagtattgatggcaatacagcgctagtcaaaggc
attgagttcttagatggcgccacggtcatggcaacagacttgcgcgcttctgcaagttta
gtgctagcaggcttggttgcacgtggggagacggtcattgaacgcatttaccatctagac
cgcggttacgaacacttagaagccaaattaaatgcgctaggcgcgaacgtaaaaagagtt
taa

DBGET integrated database retrieval system