KEGG   Methylotenera versatilis: M301_0302Help
Entry
M301_0302         CDS       T01247                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
meh  Methylotenera versatilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_0302
  Amino acid metabolism
   00340 Histidine metabolism
    M301_0302
Enzymes [BR:meh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     M301_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
342082..343380
Genome map
AA seq 432 aa AA seqDB search
MKIRRFSTTDVDFDSNLKALLAFETAQDDSIDIVVADILKDVKKRGDAAVLEYTNRFDKT
SASSLAELEISQAELTAALNGLPVDQREALKTAADRVRTYHEKQLMSSWSYTEADGTLLG
QQVTSLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVKELIMVVPTPNGERNQLVLAAAAI
SGVDRVFCLGGAQAVGALAYGTETVPQVDKVVGPGNAYVAAAKRRVFGVVGIDMVAGPSE
ILVICDGKTNPDWVAMDLFSQAEHDELAQAILLSPDADFLDKVNASILKLVEGMPRKDII
RTSLTDRGALIQVRDLEEAAEICNYIAPEHLELSMDEPLAFSKTIKHAGAIFMGRNTCEA
LGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIMVSAEGAQTLGKVAATLAYGEGLQ
AHARSAEYRLKS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagacgtttttctaccacagatgtagatttcgatagtaatttaaaagcctta
ctagcctttgaaactgcgcaagatgacagtattgatatcgtagttgccgatattcttaaa
gacgttaaaaagcgcggtgatgctgcagttttggagtacaccaaccgctttgataaaacg
agtgcgagcagcttagctgagttggaaattagccaagctgagctaactgctgcattgaat
ggtttgccagtagatcaacgtgaggctctaaaaactgccgcagaccgtgtgcgtacttac
cacgaaaagcaactgatgtcttcttggagttataccgaagctgacggtactttacttggt
caacaagtgacttcgttagaccgtgtaggtttatatgtgccaggaggcaaagcggcttat
ccatcatctgtgttgatgaatgcaattcccgccaaagtagcgggtgttaaagaacttatc
atggtcgtacctacgccaaatggcgagcgcaatcagttggtcttagccgctgctgcgatt
tctggtgtagatcgcgtattttgcctaggtggcgcgcaagcagtgggagctttggcttac
ggtactgaaactgtgccacaagtggataaagtagttggaccaggtaatgcctacgtagcc
gccgctaaacgtcgcgtattcggtgttgtaggcatcgatatggtggcagggccttctgag
attttagtgatttgcgatggcaaaaccaatccagattgggtggcgatggatttatttagc
caagctgaacatgacgaactagcgcaagcgattctattaagcccagatgctgacttttta
gataaggtgaacgccagtattttgaagttagttgaaggtatgccgcgtaaagatattatt
cgtacgtcattgacagatcgtggcgctttgattcaagtgcgtgatttagaagaggctgca
gaaatctgtaactacattgcacctgagcatttggaattatctatggatgagccgctagca
ttcagcaaaaccatcaagcatgcaggtgccatatttatgggtcgcaacacatgtgaggcg
ctcggtgattactgcgcaggaccaaaccatgtattgccaacttcacgtacagcacgcttc
tcatcaccattaggtgtatatgatttccaaaagcgctcaagcttaattatggtgtcggct
gaaggcgctcaaacgttaggaaaagtagccgcaaccttggcttatggagaaggcttgcaa
gcacatgccagatcagctgaatataggttaaaaagctaa

DBGET integrated database retrieval system