KEGG   Methylotenera versatilis: M301_0383Help
Entry
M301_0383         CDS       T01247                                 

Definition
Aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:meh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
413210..414154
Genome map
AA seq 314 aa AA seqDB search
MNTETLEASPLDANTLQTKKRLKLHAHVMQTQDESGLQYLEVDNPLCTARIALQGAHVMA
WQPKFLVQPVLWLSSNARYVKGRSIRGGVPICWPWFGAHPTDSTFCPHGFARVIPWRVID
VDATPTGATRIMLEMADTPEAKRQLSYPYTLVATITVGRRLRVDLATTNQADHPFVISEA
FHTYLNISDIANVKITGLQDCVYSDKMLKYERHVEHNPLTFDGEFDRVFINHSSDCTVHD
KGYNRLIHVSKSGSDTTVVWSPGAEKSAQMADMGAPDEWRKMVCVETTNAMDNMVVINPG
RTHVISAEYAVETL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagacattagaagctagcccattagatgcaaatacgcttcaaactaagaag
cgtttgaagcttcacgcgcatgtgatgcaaacgcaagatgaaagtggcttgcaatatctt
gaggtggataatccactttgtacagctagaatcgccctgcaaggtgcgcatgtcatggct
tggcagcctaagtttttagtgcaaccagtattatggctttctagcaatgcacggtatgta
aaaggtcgttcaatacgcggtggcgtacctatctgctggccttggtttggtgcacatcca
acagacagtactttttgtccgcatggctttgcacgcgttatcccttggcgtgtgattgat
gtcgatgccacgccaacgggcgctacgcgtattatgttggaaatggccgatacgccagaa
gccaaacgtcagctttcatatccgtatacactcgttgcaaccattacagttggtcgacgt
ttacgggttgatttagccacgactaatcaagcagaccatccgtttgtgattagtgaagca
ttccatacttatttaaacattagcgatattgctaatgtgaaaattacaggtctgcaagat
tgtgtgtattcagacaaaatgctgaaatacgaacgtcatgtggagcataatccgcttaca
tttgatggtgaatttgatcgcgtatttatcaaccacagctcagattgtacggtgcatgat
aaaggctacaatcgtttgattcatgtatcaaaatcaggcagtgataccacagtagtgtgg
agtccaggcgctgaaaaatctgcacaaatggcagacatgggtgcgccagatgaatggcgt
aaaatggtttgcgtagaaacgactaacgcgatggataatatggtggtgattaatcctgga
agaacgcatgtgattagtgccgaatacgcagtcgagacgctataa

DBGET integrated database retrieval system