KEGG   Methylotenera versatilis: M301_0416Help
Entry
M301_0416         CDS       T01247                                 

Definition
phospholipase A(2) (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
meh  Methylotenera versatilis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:meh00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:meh00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:meh00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:meh00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
454758..455888
Genome map
AA seq 376 aa AA seqDB search
MNNFKSKTMRAFFLVLWMPTALLAQETVTVEQALIKCKKLYPNDFEAKKRLSCFDSINTP
KELLEEAANTLTNSPEQVHSVNSAPVITPAIAIEKPSPKLSYLERKWRLTSQGDWNISDF
ETYKSNYLLITKTNNTNDMPQSPSQLNNVDRNLDDKDLKFQISLKTEVMNNIPLIRNLPY
VTSSRIWAAYSQQSNWQVFDSKASRPLRENNYEPEIMLSLGIDNQVNGEKKHYIPRMLNL
GLVHQSNGRSNPTSRSWNRLYLESGWELTDNVSLMVRPWWRIPESQDDNPDIEKYLGYGD
MAIRWEDDNRKNAATLTLRNNLRSDNKGYAQLDLQRQVLNNPYLKLHLMASTGYGASLLD
YNYDQTIFGIGISLGE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattttaaaagtaaaactatgcgagcgtttttcttagttttatggatgcctaca
gctttattagcgcaagaaaccgtgacagtagaacaagctttaatcaagtgtaagaaactt
tatcctaatgatttcgaggcaaaaaaacgcttatcttgctttgatagtattaatacccct
aaagagctcttagaagaagccgctaacacactaactaatagcccagaacaagtgcattcg
gtaaactcagcaccagtaattactccagctatcgcgattgaaaaaccaagtccaaagtta
agttatttggaaagaaaatggcggctgacctcacaaggtgactggaatataagtgatttt
gaaacctataaatctaattacttattaatcaccaaaaccaataacacgaatgatatgcct
caatcacctagtcaattgaataatgttgatagaaacctagatgacaaagacttaaagttt
cagatcagcttgaaaaccgaggtgatgaataacatcccgcttattcgtaatttaccttat
gtcactagctctagaatatgggcggcttattcacagcagtcaaattggcaggtgttcgac
tcaaaagcatcaagaccgctacgtgagaataattatgagcctgaaatcatgttatctcta
ggcatagataatcaggtaaacggagaaaagaagcactatattccaagaatgttaaatcta
ggcttagtacatcagtcaaacgggcgctctaatcctacttcaagaagttggaatcgcttg
tatctcgaaagtggttgggaattgaccgataatgtctctctcatggtgcgcccttggtgg
cgaatacctgaaagtcaagatgataatcctgacattgaaaagtatctaggttatggagac
atggcaattagatgggaagatgataatcgtaaaaatgcggcaaccttaacactaagaaat
aatctacgcagcgataacaaaggatatgctcagctagatttgcaaaggcaagtgctcaat
aacccatatttgaaattacatctgatggcttcaacgggttatggtgcaagcttgctagat
tacaactacgaccaaacgattttcggcattggcatctcgcttggtgagtag

DBGET integrated database retrieval system