KEGG   Methylotenera versatilis: M301_0533Help
Entry
M301_0533         CDS       T01247                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
meh  Methylotenera versatilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_0533
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M301_0533
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     M301_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
585108..586271
Genome map
AA seq 387 aa AA seqDB search
MTAVESQLLASPSSNSSSLLLEAKVIVVKVGSSLVTNNGNGLDQAAIAAWAAQIAALVQQ
GKQIVLVSSGAVAEGMQRLGWKKRPTAVNELQAAAAVGQMGLVQMYESCFTEHQLHTAQV
LLTHDDLADRKRYLNARSTLRTLLDLKVIPIINENDTVVTDEIRFGDNDTLGSLVANLIE
ADTLVILTDQQGLYSADPRKDKDAKFIQHATAGDVTLEQMAGGAGSSVGTGGMLTKILAA
KRASRSGANTIIASGRERNVLVRLAAGEVIGTHLQTTEMKTTARKQWLADHLQLRGKLTL
DAGAVKVIKQDGKSLLPIGVTAVEGSFERGEVVACCDENGVELARGLVNYSAMEATRIMR
KSSKDIEKILGYVEEAELIHRDNLVLL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtggaatcacaattgctagcttcaccatcatctaattcatcgtcacttttg
cttgaagccaaagtgatcgtagtgaaagttggctctagtcttgtcaccaataatggtaat
ggtttagaccaagcggcaattgctgcttgggcggcgcaaattgccgctttggtgcaacaa
ggcaagcagattgtattagtttctagtggtgcagttgctgaaggtatgcaaagattgggt
tggaaaaaacgcccaacggctgtgaatgaattgcaagctgcagcagctgtaggtcaaatg
ggtttggtgcagatgtacgagagctgttttactgaacatcagttacatactgcgcaagtg
ttgttaacccatgatgatttggctgacagaaagcgctatttgaatgcgcgcagcacttta
cgtactttgcttgatttaaaggtgatccctatcatcaacgagaatgatacggtagtgact
gatgaaattcgctttggtgataatgacactttaggttcattggtggctaatttaatcgaa
gctgatactttagtgattttaacggatcagcaaggtttgtattctgctgacccgcgtaaa
gataaagatgccaagtttatacaacatgctactgcaggtgatgtaacactagagcagatg
gccggcggtgctggtagcagtgttggcactggcggaatgttaaccaagattcttgctgca
aagcgcgcttccagaagtggtgcaaatactatcattgcctcaggtcgtgaaagaaacgtg
ctggttcgtttagccgctggtgaagtaattggtactcatctgcaaaccacagaaatgaaa
acgaccgcgcgcaagcaatggttagccgatcatttacagttacgcggaaagttaacgtta
gatgcaggcgcggtaaaagtcatcaagcaagatggcaaaagtttattgccaattggcgta
acagctgttgaaggtagctttgagcgcggcgaagtcgttgcttgttgcgatgaaaatggc
gtggagttggcgcgtggtttagtcaactactcagccatggaggcgactagaatcatgcga
aaatctagcaaagacattgagaaaatattgggctatgtggaagaggcggaattgatacac
agagacaatttagtcttgttgtaa

DBGET integrated database retrieval system