KEGG   Methylotenera versatilis: M301_0601Help
Entry
M301_0601         CDS       T01247                                 

Definition
Disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
meh  Methylotenera versatilis
Brite
Enzymes [BR:meh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     M301_0601
Secretion system [BR:meh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   M301_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
661079..661807
Genome map
AA seq 242 aa AA seqDB search
MFKKLVSFTLLSAACVGVSTSAIADEASVKKAVEAAYPKFKVESVAKTPYAGLYEVFMGG
QIIYTDEKMSFLIAEGHLVDPKTKKDITGERMEELTKIDFSTLPLDQAIKVVKGNGSRKL
VVFSDVDCPYCKRLEQNELTNITDVTVYTFLYPIQQLHPDSANKSKAIWCASNRVKAWQD
WILNGQLPSSAGNCEVPIEKIGDLARKLGVTSTPTLIFADGKRMLGAQPYKDIERAMVAA
KK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaattagtcagctttactttattaagtgctgcatgcgttggagtttcaact
tctgcaatagccgatgaagcaagtgtgaaaaaagctgtagaagcagcttacccaaaattt
aaggtagagagcgtagcgaaaacaccttacgcaggtttgtatgaagtatttatgggtggt
cagattatctacaccgatgaaaaaatgtctttcttgattgcagaaggacatttagttgac
cctaaaactaaaaaagacattactggcgaacgtatggaagagttaaccaaaattgacttc
tctacactgcctttagatcaagcgattaaagtggtaaaaggtaatggtagccgtaaatta
gtcgtgttttcggatgtagattgcccatattgcaagcgtttagagcaaaatgaattaact
aatatcactgatgtgaccgtttatacttttctttatccgattcagcaattacatccagat
tcagcgaataaatctaaagcgatttggtgcgcaagcaatcgggtaaaagcttggcaagac
tggattttgaatggtcaattacctagctcagctggtaattgcgaagtaccgatcgaaaaa
attggcgacttggcgagaaagcttggagttaccagtacgcctacgttgatatttgcagat
ggtaaacgtatgttaggtgcacaaccttataaggacattgaacgggctatggtggcagct
aaaaagtaa

DBGET integrated database retrieval system