KEGG   Methylotenera versatilis: M301_0670Help
Entry
M301_0670         CDS       T01247                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:meh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:meh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:meh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:meh00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
737501..738823
Genome map
AA seq 440 aa AA seqDB search
MAIQDILVPDIGNFDSVDVIEILVKVGDTVAKEDSLMTVESDKASMDIPSPFAGVVKELK
MKVGDKAAQGGLILTMDVSDAAAAPVEEVKAAAPQPAAAVAIPEPSRPAPEPPKTIAPAQ
QPVPVGASAVVDAGKLSHASPSVRKFARELGVNLAFVKGSAPKNRIVQADVQSYVKGELA
KPRTENMGAGVSGFAALPMPVIDFSQFGAIENKPLSRIKKLSGANLHRNWVTAPHVTQFD
EADITDLEDFRKSMQADAEKRGVKLTMLAFLIKASVNALKAYPNFNSSLSPDGDSLILKS
YFNIGFACDTPDGLVVPVVKDVQQKDVLDIARDLGELSTKARERKLKVEEMQGGCFTISS
LGGIGGTMFTPIINCPEVAILGVSRSSMQPVYDPKTKAFEPRLMLPMSLSYDHRVVDGAD
GARFTSHMRMMLSDVRRLLL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcaagacatacttgtccccgacatcggcaattttgatagtgttgatgttatt
gaaatattagttaaagtgggtgacacagtcgctaaagaagattcacttatgacggttgaa
tctgacaaagcttctatggatattccttcaccttttgccggtgtggtaaaagagttaaaa
atgaaagttggcgacaaagccgctcaaggtggtttgattttaacgatggacgtaagtgac
gcagcggctgctccagttgaagaggtgaaggcagccgcaccgcaaccagctgctgcagtg
gcaattccagagcctagtcgtccagcgccagagccaccaaaaaccattgcaccagctcaa
cagcctgtgccagttggtgctagcgcagtcgttgatgcaggcaagctatcgcatgccagc
ccatcagtacgtaagtttgcacgtgagttaggtgttaacttagcttttgtaaaaggtagt
gcgcctaaaaaccgtattgtacaagccgatgtacagtcttatgtaaaaggcgaattggct
aaaccgcgtacagaaaatatgggcgcaggcgtcagcggctttgcggctttacctatgcca
gtaattgatttcagccaatttggtgctattgagaataaaccactttcacgcattaaaaaa
ttatcaggcgcaaacttacatcgtaactgggtgacggctccgcatgttacgcaatttgat
gaagctgatattactgatttggaagactttagaaagtctatgcaagccgatgccgagaaa
cgtggcgttaaactcactatgttggcctttttgattaaagcctctgtgaatgcgcttaaa
gcttacccaaactttaactcatcactttcacctgatggcgatagcttaatcttaaaaagt
tatttcaacattggcttcgcttgcgacacgccagatggcttggtagtgccagtggtcaaa
gatgttcagcaaaaagacgtactggatattgcccgtgatttaggcgaactttcaaccaaa
gcgcgtgaacgcaagcttaaggtagaagaaatgcaaggtggctgcttcactatttcaagc
ttaggtggtattggcggtacgatgttcacgcctatcattaactgccctgaagtggcaatt
ttaggtgtatcacgctcaagtatgcagccagtgtatgaccctaaaactaaagcttttgag
ccacgtttaatgttgcctatgtcactatcttacgaccaccgtgtggttgatggagctgat
ggtgctcgcttcacaagccatatgcgcatgatgttgagtgatgtgcgtaggttgttgctg
taa

DBGET integrated database retrieval system