KEGG   Methylotenera versatilis: M301_0670Help
Entry
M301_0670         CDS       T01247                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
meh  Methylotenera versatilis
Pathway
meh00010  Glycolysis / Gluconeogenesis
meh00020  Citrate cycle (TCA cycle)
meh00620  Pyruvate metabolism
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01120  Microbial metabolism in diverse environments
meh01130  Biosynthesis of antibiotics
meh01200  Carbon metabolism
Module
meh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_0670
   00020 Citrate cycle (TCA cycle)
    M301_0670
   00620 Pyruvate metabolism
    M301_0670
Enzymes [BR:meh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M301_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N PYNP_C
Motif
Other DBs
NCBI-ProteinID: ADI29054
UniProt: D7DNN7
Position
737501..738823
Genome map
AA seq 440 aa AA seqDB search
MAIQDILVPDIGNFDSVDVIEILVKVGDTVAKEDSLMTVESDKASMDIPSPFAGVVKELK
MKVGDKAAQGGLILTMDVSDAAAAPVEEVKAAAPQPAAAVAIPEPSRPAPEPPKTIAPAQ
QPVPVGASAVVDAGKLSHASPSVRKFARELGVNLAFVKGSAPKNRIVQADVQSYVKGELA
KPRTENMGAGVSGFAALPMPVIDFSQFGAIENKPLSRIKKLSGANLHRNWVTAPHVTQFD
EADITDLEDFRKSMQADAEKRGVKLTMLAFLIKASVNALKAYPNFNSSLSPDGDSLILKS
YFNIGFACDTPDGLVVPVVKDVQQKDVLDIARDLGELSTKARERKLKVEEMQGGCFTISS
LGGIGGTMFTPIINCPEVAILGVSRSSMQPVYDPKTKAFEPRLMLPMSLSYDHRVVDGAD
GARFTSHMRMMLSDVRRLLL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcaagacatacttgtccccgacatcggcaattttgatagtgttgatgttatt
gaaatattagttaaagtgggtgacacagtcgctaaagaagattcacttatgacggttgaa
tctgacaaagcttctatggatattccttcaccttttgccggtgtggtaaaagagttaaaa
atgaaagttggcgacaaagccgctcaaggtggtttgattttaacgatggacgtaagtgac
gcagcggctgctccagttgaagaggtgaaggcagccgcaccgcaaccagctgctgcagtg
gcaattccagagcctagtcgtccagcgccagagccaccaaaaaccattgcaccagctcaa
cagcctgtgccagttggtgctagcgcagtcgttgatgcaggcaagctatcgcatgccagc
ccatcagtacgtaagtttgcacgtgagttaggtgttaacttagcttttgtaaaaggtagt
gcgcctaaaaaccgtattgtacaagccgatgtacagtcttatgtaaaaggcgaattggct
aaaccgcgtacagaaaatatgggcgcaggcgtcagcggctttgcggctttacctatgcca
gtaattgatttcagccaatttggtgctattgagaataaaccactttcacgcattaaaaaa
ttatcaggcgcaaacttacatcgtaactgggtgacggctccgcatgttacgcaatttgat
gaagctgatattactgatttggaagactttagaaagtctatgcaagccgatgccgagaaa
cgtggcgttaaactcactatgttggcctttttgattaaagcctctgtgaatgcgcttaaa
gcttacccaaactttaactcatcactttcacctgatggcgatagcttaatcttaaaaagt
tatttcaacattggcttcgcttgcgacacgccagatggcttggtagtgccagtggtcaaa
gatgttcagcaaaaagacgtactggatattgcccgtgatttaggcgaactttcaaccaaa
gcgcgtgaacgcaagcttaaggtagaagaaatgcaaggtggctgcttcactatttcaagc
ttaggtggtattggcggtacgatgttcacgcctatcattaactgccctgaagtggcaatt
ttaggtgtatcacgctcaagtatgcagccagtgtatgaccctaaaactaaagcttttgag
ccacgtttaatgttgcctatgtcactatcttacgaccaccgtgtggttgatggagctgat
ggtgctcgcttcacaagccatatgcgcatgatgttgagtgatgtgcgtaggttgttgctg
taa

DBGET integrated database retrieval system