KEGG   Methylotenera versatilis: M301_0677Help
Entry
M301_0677         CDS       T01247                                 

Definition
FAD linked oxidase domain-containing protein
Orthology
K03777  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
meh  Methylotenera versatilis
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:meh00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
752037..753407
Genome map
AA seq 456 aa AA seqDB search
MSSADFLSKLAQLLPIAQVYTDPVDCYAYAYDNSRIFHAPIAVVFPLNTTEVQAVIKLCN
AHKVPVVPRGRGTGTAGGSVPEAGGVALSLERMNKIISVDPDNRMAIIEPGVLNQELQDA
IKGVGFFWPPDPSSAAYCSIGGNLATCAAGPHAVKYGVARDHVLGLKAVTGNGDIIKTGC
YTSKGVVGYDLTRLLVGSEGTLAVIVEATLKLTPLPKHTGGITAEFADTASCARAIAAIM
AQPYTPSALEFLDNGALNLIRGRHKNLLPENARAYLMIEVDGAQQEIIEATQAILQACQV
DGLIEAKPAEDTKALWAARKALSPLLKDIAPKKINEDIAVPVSHLPELLTGLEKLAAQYK
ISNVNFGHAGNGNIHVNLLVNPDNADEMKRAYECLDDVFSLVLSLQGTLSGEHGVGMAKR
PFISREIDETTINLMKAVKLTFDPNNILNPGKLFPK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgctgattttttatctaagctagcgcagcttctgcctatcgcacaggtctat
accgatccagtagattgctacgcctatgcttatgataattcgcgcatctttcatgcgcct
atcgccgtggtttttccgctgaataccaccgaagtgcaagcggtgattaagctttgcaac
gctcacaaagtgccagtggtgccgcgtggtcgtggcacgggcactgcgggcggtagtgtg
ccagaagccggtggtgtggccttgtccttagagcgcatgaataaaattatcagtgtagac
ccagataatcgtatggcgattattgagcctggcgtgctaaatcaagagctacaagatgca
attaaaggcgtcggtttcttttggccgccagatccatcaagtgcggcttattgcagcata
ggcggtaatctagcgacttgcgccgcaggcccacatgctgtgaagtatggtgttgcacgt
gaccatgtgctcggtttaaaagcggtgacaggtaatggcgatatcattaaaacaggttgt
tacaccagtaagggtgtggtcggttacgatttaacgcgattattggttggttctgaaggt
acgctggccgtgattgttgaggcgacacttaagctcacccctttgccaaaacacactggc
ggcataactgctgagtttgctgatactgccagttgcgcgcgcgcgattgcagcgattatg
gcgcagccatatacgccaagtgcattggagtttttagataacggcgccttgaatttgatt
cgtggtcgccataaaaacctgttgccagaaaatgcccgcgcttacttgatgatagaggtc
gatggtgcgcagcaagagattattgaagccacgcaggcgattctgcaagcgtgccaagta
gatggcttgattgaggcaaaacctgcggaagataccaaagcattatgggctgcacgcaag
gctttatcgccattgcttaaagatattgcaccgaagaaaatcaatgaagatattgctgtg
ccggtgtcacatctacctgaattgttaacaggcttagagaaactagccgcgcaatacaag
atttcaaacgtgaattttggtcatgcaggcaacggtaatattcatgtgaatttattggtc
aatcctgataatgctgatgaaatgaaacgtgcttatgagtgcttagatgatgtgtttagt
ttggtgctttctctgcaaggcacgctatcgggtgagcatggcgttggcatggcgaagcgt
ccatttatttcacgtgagattgatgaaacaaccattaatttaatgaaagccgttaagtta
acgtttgacccgaataatattttgaatccgggtaagttgtttcctaagtag

DBGET integrated database retrieval system