KEGG   Methylotenera versatilis: M301_0695Help
Entry
M301_0695         CDS       T01247                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
meh  Methylotenera versatilis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:meh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:meh00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:meh00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:meh00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
776218..776562
Genome map
AA seq 114 aa AA seqDB search
MLIELLTKRYPGMRAWLTQRLSALVMAVYSIFAVARFLIVQPSNYGAWVDFFQPLWWRIA
TLLFWISLCIHAWLGIRDVFKDYVPNPSVRDVLDKLLVVSLWVYLVWATWLLLA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgaacttttaactaaacgatatccaggcatgcgtgcttggttaacacaaaga
cttagcgcgttagtgatggcggtttacagcatttttgcagttgcaagattcttaatcgta
cagcctagtaattatggtgcttgggttgatttctttcagccactttggtggcgcatcgct
actttattgttttggattagcttgtgtattcatgcatggttaggtattcgcgatgtgttt
aaagattacgtacctaacccaagcgtacgcgacgtgttagataaacttttagtggtgtca
ttatgggtttatttagtttgggcaacctggttactgctagcttag

DBGET integrated database retrieval system