KEGG   Methylotenera versatilis: M301_0857Help
Entry
M301_0857         CDS       T01247                                 

Definition
MCP methyltransferase/methylesterase (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
meh  Methylotenera versatilis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:meh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:meh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
975694..978621
Genome map
AA seq 975 aa AA seqDB search
MVNTKNQLVSPSSEKPTEVDQKSKRVFPIVGIGASAGGLEAFEDFFRHCDPDIGLAFVLV
PHLDPSHVSMLTEILQRSTKMPVIEAQDQTKVEANRVYIIPPNREMAIIHGKLQLSVPTV
SHGQRMPIDGFLRSLAEDQNENAIGIILSGTGSDGTLGLRAVYGAGGNCFVQEPATAKYD
GMPTSAIKAGYVTKVLPVANMPEALQAGANSFNILSEINTETKKTHGVSHILMQLRTITG
HDFSLYKQSTVIRRIERRMLKHDITDIEIYARYLKEFPAEAHILFKELLINVTSFFRDTE
AFLVLENDVLPQLCLNKSDEDNFRVWVPGCASGEEAYSIAILLSELMDKTQQNFKVQIYA
SDLDDDAIATARAGLYPINISQDLTPERLRRFFTKEITGYKVKKEIRDMVVFAIQNVIKD
PPFTKLDLLSCRNLMIYLGAELQNRLMPTFHYALKPNGVLMVSPSEGIGSFTSLFSPISR
KWKIYRAIHNLSSPTSRFNIPTKVPTTNDSKTPEKAIKQPMENSLAEISRRLLMQYFAPA
SVFTDLKGNILYVHGDTGKYLRPAQGQASLNVIEMAREGMEIQLRAAIHSASIENKPTLN
HEMQVKTNGGFTTVSLSVRQVNYGSADKQAFLLVSFQDVVTPSNQTKRKVSSKPEELKRL
EELENDLLYLKENHQVLIEEQQATNEELKSANEELQSTNEEMQSSNEELETSKEELQSIN
EELITVNSELQTKMDQLSEMQSDMKNLLESTDIGIVFLDEHLMIRSFTREAVRIYRLVPS
DIGRPLSDIRSISDQADNLIEAAKNVLDSLIPFETELHVLNNWILVRIQPYRTTDNFING
VVLTFTDITARIKSATTQEALDLAEGIVNTVREPLIVLDAKMNVISINTAFETSFQVSRE
DAIGRKIYQLGNFQWDIPALRKLLEELLITSDSIDDYVVHHDFPGIGHKTIRIKARRLVT
KMIETQLILLSFEIN
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaatacaaaaaatcaattagtatcaccgtcatcggaaaagcctaccgaagtcgat
cagaagtcaaaaagagtttttcccattgttggaattggtgcttcagctggcggtttagag
gcttttgaagattttttccgtcactgcgatcccgatatagggcttgcatttgttttagtg
cctcatcttgatcctagccatgtgagcatgctcaccgaaatcttacaacgcagcactaaa
atgcctgtgatagaggcgcaagatcagactaaggttgaagctaaccgcgtgtatatcatc
ccgccaaatcgtgaaatggcgatcattcacggcaagttgcaactgagtgtaccaacagtt
tctcatgggcagcgtatgccgatagatggttttttaagatcactggctgaagaccaaaat
gaaaatgcgataggtatcattctttcaggcactggcagtgatggcaccttgggtttgcgt
gctgtttatggcgcaggcggcaattgctttgtacaagagccagcgacagctaaatatgat
ggtatgccaaccagtgcaattaaagcgggttatgtaacaaaagttttacccgtcgcaaac
atgcctgaagcgctgcaagccggtgctaactccttcaatatactcagtgagataaacacc
gaaactaagaaaacccatggggttagtcatattttgatgcagttgcgcactatcactggg
catgacttttcgctttacaaacaaagcactgtgattcgacgtatcgaacgacgcatgtta
aagcacgatattacagatattgaaatttatgcgcgttatttgaaagagtttccagctgaa
gcacatattctattcaaagaattactcatcaatgtcaccagtttctttcgcgatacagaa
gcttttctggtgttagaaaatgatgttttgccgcagctatgcttaaacaagtctgatgaa
gataatttccgtgtttgggtgcctggttgcgcttctggtgaagaagcatattcaattgct
attttacttagcgagctgatggataaaacccaacaaaatttcaaagtacagatttatgct
agcgatctggatgatgatgccattgcaacggccagagcaggcttatacccaattaacatc
agtcaagatctcacaccagaacgcttacgccgcttttttactaaagaaataactggctat
aaagttaaaaaagagattcgtgacatggtggttttcgcgattcaaaacgtcattaaagac
cccccatttaccaaacttgatttactctcatgccgtaacctgatgatttatctcggcgca
gagttacaaaataggctaatgccaacatttcattacgcactaaaacctaatggggtgttg
atggtgtcaccatcagagggaattggtagctttacctcgttattttcaccgattagtcgc
aagtggaaaatctaccgtgctatacataatctgagttcaccaacctcaagatttaatatt
ccgaccaaagttcctacaacaaatgacagcaagacacctgagaaagcgataaaacaacct
atggaaaatagtttggctgaaataagccgtcgtctgttgatgcaatactttgctccggca
tctgtatttaccgacctaaaaggcaatattctttatgtacatggtgatacgggaaaatat
ctgcgtcctgctcagggacaagctagtttaaatgtcattgaaatggcacgcgagggtatg
gaaatacagctacgtgcagctatccactcggcaagcatcgaaaataagccaacactcaat
catgaaatgcaagtcaagaccaatggtggttttaccacggttagtttaagtgtacgacaa
gttaactatggttcagctgataagcaggcatttctattggtgagctttcaggatgtagtg
acgccttctaatcaaacaaaacgtaaggtttctagcaagccggaagagctaaaacgctta
gaggagcttgaaaatgatttgttatacctaaaagaaaaccaccaagttctcatcgaagag
cagcaagctaccaacgaagagcttaagtccgccaacgaagagctacaatcgaccaatgag
gaaatgcagtctagcaacgaagagttagaaacctcgaaagaagagttgcagtcgattaat
gaggagctcattacggtcaattctgagctgcagacaaaaatggatcagttgtctgaaatg
cagagcgatatgaagaatctattggaaagcacagatattggtatcgtttttttagatgaa
cacttaatgattcgcagctttactcgggaagcagttcgcatctatcgattagtaccatcg
gatataggcagaccactttctgatattcgatccatttctgaccaagctgacaatcttatc
gaggcagctaaaaacgtattggactcactgattccttttgaaaccgagttacatgttctc
aataactggatattggtgcgcattcagccttaccgcactacagacaactttattaatggc
gttgttttaacctttactgacatcacggcccgtattaagagtgctactacccaagaagca
ctagacttggccgagggcatcgttaacactgtacgtgaaccactgatagtactagatgcc
aaaatgaatgtgatttccattaatactgcttttgaaacaagctttcaagtgagtcgagaa
gatgccattggcagaaaaatttatcagttgggaaactttcagtgggatatacctgcctta
cgtaaattactagaagagttattaattaccagcgactctatagacgactacgtagtacat
cacgactttcctggaattggccacaaaactattcgaattaaggcacgccgcttagtaacc
aagatgattgaaacacagttgatattactgtcatttgagatcaattaa

DBGET integrated database retrieval system