KEGG   Methylotenera versatilis: M301_0958Help
Entry
M301_0958         CDS       T01247                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
meh  Methylotenera versatilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:meh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M301_0958
DNA repair and recombination proteins [BR:meh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M301_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1082851..1083447)
Genome map
AA seq 198 aa AA seqDB search
MKNPPALEQLIDSLRCLPGVGPKSAQRMAYYLLQRDRNGASALSAALETALEVVDHCKLC
NTFSEQPICPLCAADNRDKNLLCVVEMPTDLLMLENTHAFMGMYFVLMGRLSPLDGIGPK
EIHLDKLIKRAQDGLVNEVILATNYTVEGEATAHYISELLKTRGIKTSRIARGMPMGGEI
EYVDSGTLAQAMMERRNV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcctccagcacttgaacagttgattgatagcttacgctgtttacccggtgtc
gggccaaagtctgcgcagcgcatggcgtattatctcttacaacgcgatagaaacggtgcc
agcgcactatcggctgccttagaaaccgccttagaggtcgttgatcattgcaagttgtgt
aacacttttagcgagcaacccatttgcccattatgtgctgccgataatcgcgataaaaat
ttgctgtgtgtggtagaaatgcctacagacttgttaatgctggaaaatacacatgccttt
atgggcatgtactttgtgttaatgggtcgattatccccgcttgatggcataggtcccaaa
gaaattcatttagacaaactcattaaacgcgcgcaagacggattagtgaacgaggtcatt
cttgctactaattacacagttgaaggtgaagccactgcacattacatcagcgaattactt
aaaacacgtggtatcaaaactagccgtatcgcgcgtggcatgcctatgggtggtgaaatt
gagtatgtagatagcggcacgcttgcacaggcgatgatggaacgacgtaatgtttag

DBGET integrated database retrieval system