KEGG   Methylotenera versatilis: M301_0961Help
Entry
M301_0961         CDS       T01247                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
meh  Methylotenera versatilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1085950..1087869
Genome map
AA seq 639 aa AA seqDB search
MSNQSKSSKPALVPLDIARETFKQMALRRVVPSPDNYLLIYNEIAGITVKETAESAIRKA
LKQLPNETTEQSKWINRWDKLLKQENWADLPILLNDSMDANVAVSKQWPDAIRELIQNWD
AKQVGLDVARKKEALEKVLINFGSDPLLAQKLQALANNWKAYGVSDASASKTIEVIEQAE
VKPLNLSDAVLGDAVLESQALVAPTLNTPSLKLPETLNPGYEPDQFQETFRALQDMLKQS
LNHGLIPRLDGYPELKEEAEQIFALSEKARKLKDWQAVVKQFRALLVRVEIIGANEEGIK
QDLLNLLKLLIDNIGELVADDQWVRGQVTSVQTIISGTLDRALIVDAERSLKEVIFKQGM
LKHSLADAKNAFKSMIATFVDRLSHMTNSTDTYQSKVGQYADKLAETEDIAQINILLEGL
MKDTHTMQTDIVRSRDSMMQQTAEVEVAQQKIQQLQAELSQLSEKVSIDQLTGVLNRRGL
DEAMLREISRAQRGASSLCVALLDIDNFKHFNDNYGHNVGDTALQHLAKVIQETLRPTDI
AARFGGEEFVILLPDTTIDAAVETISRLQRALTKQFFLGNNERLLITFSAGIALFRETEE
QATILNRADQAMYLAKKSGKNRVMTEVDLEYSSQKLAPT
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccaaagtaaatcaagcaaacctgcactcgtaccgctagatatagcgcgtgaa
acctttaagcaaatggcgttgcggcgcgttgttccttcgccagataattacttgcttatc
tataatgaaatagcaggcattacagtcaaagaaactgctgaatcagccattagaaaagca
cttaaacagctacctaatgaaacgaccgagcaaagtaaatggattaatcgctgggacaaa
ctattaaagcaagaaaactgggctgacttgcctatattgttgaacgatagtatggatgcg
aatgtggcggtatccaagcagtggcctgatgcgattcgcgagctcatccaaaattgggat
gctaagcaagtggggttggatgttgcaaggaaaaaagaagcgttggaaaaagtgctgatt
aactttggcagcgatccacttttagcgcaaaaattgcaagcactcgctaataattggaaa
gcatatggtgtgtcagatgcatctgcttctaaaacgattgaggttatagagcaagctgaa
gtcaagccgcttaatttaagcgatgcggttttaggtgacgcagttttggaaagccaagct
ttagtcgcaccaacgttaaacacgccaagtttgaagttaccagaaacccttaatcctggc
tatgaaccagaccaatttcaagaaacgtttcgagcgttgcaggatatgttaaaacaatca
ctcaatcacgggctgataccgagattggatggttatccagagctaaaagaagaggctgag
cagatatttgcgttgtctgaaaaagcacgtaaattaaaggattggcaggcggtcgttaag
caatttagagcactgttggtaagagtcgaaataattggcgcgaatgaagagggcatcaaa
caagatttattgaatttacttaaattattgattgataacattggtgagttagtcgcagat
gatcaatgggtacgtggacaggtgacttctgtacaaaccattatctccggtacgctagat
agagcgttgattgtcgatgcagagagaagtctgaaagaagtcattttcaaacaaggcatg
cttaaacatagtttagccgatgctaaaaatgcattcaaaagtatgattgcgacgtttgtt
gaccgcctgagccacatgactaactcgaccgatacctatcaaagtaaagtagggcagtat
gctgataagttggctgaaactgaggatatcgcacaaattaatatcttgttagaaggttta
atgaaagatacgcatacgatgcaaacagatattgtgcgatctcgtgattctatgatgcag
cagacagcagaggttgaggtcgcacaacagaaaatacagcagttgcaagctgagttatct
caattaagtgaaaaagtatcgatagatcaattgacgggggtgcttaatcgccgtggttta
gacgaggctatgctgagggaaatatcacgtgcacaacgcggcgctagctcgctgtgtgtg
gcattgctggatattgataactttaaacattttaatgataactacgggcataacgtgggt
gataccgccttgcagcacttggccaaagtgattcaggaaactttacgaccaaccgatatc
gcagcacgatttggtggagaagagtttgtaatattattaccagataccactattgatgcg
gcggttgaaacgatttcacgattacaacgtgcgctcaccaaacagttctttttaggtaat
aacgagcgattgttaattacttttagtgcgggtattgcattgtttagggaaactgaagag
caagctaccattttgaatagagctgaccaagcgatgtatcttgctaaaaaatctggtaaa
aatcgtgtaatgactgaagttgatttagagtatagctcgcaaaaattagcccctacataa

DBGET integrated database retrieval system