KEGG   Methylotenera versatilis: M301_1048Help
Entry
M301_1048         CDS       T01247                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
meh  Methylotenera versatilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    M301_1048
Enzymes [BR:meh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     M301_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1172583..1173545
Genome map
AA seq 320 aa AA seqDB search
MDHGFAFSSTGGFLGLPITDLPISENESEQKRAAGTFAVAGITWDGCVTNRPGARFGPNA
IRQASHMLCGDEHPLFDVTPVDNTLDLGNLLLPNTSLESMRAALMPQASALIGQYEMVWL
GGDHSITLPLLRAYFAHYKQPLACIHFDAHCDTWESHFGEPSGHGTWVYEAITEGLVDPK
CFIQIGIRSSGERAAREFVNDQGGRIFTARELRGKDGVGLQSVIDEVRERMAKADNPPLY
LSFDIDALDPAFAPGTGTPEVGGLTTAQAMTLLEAWHDLNWVGMDLCEVSPPYDHAELTS
NAAATLMWTWLCGRIVAKRT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatcacggttttgcatttagctctacaggaggttttctcggtctgccaatcacagat
ttgcctatttcagaaaatgagtctgagcaaaaaagagccgccggtactttcgccgtagca
ggtattacgtgggatggctgcgtgaccaatcgacctggtgcgcgctttggacccaatgct
atacgccaagccagtcatatgctgtgcggagatgagcatccattatttgatgttactcct
gtcgacaataccttggatttagggaatttattgctacccaatactagtcttgaaagcatg
cgcgctgcgcttatgccacaagctagtgcgttaattggtcaatacgaaatggtttggtta
ggtggtgaccactcaattactttgcctttgttacgtgcttattttgcacattacaagcag
ccactcgcgtgcattcattttgatgcccactgtgatacttgggaaagtcattttggcgaa
ccctctggacatggcacttgggtgtatgaagcgattaccgaaggtttggttgatcctaaa
tgttttatacaaattggcatacgttcatctggtgagcgtgctgcccgcgaatttgtgaat
gatcaaggcggcagaatcttcaccgcacgtgaactacgtggtaaagacggagtaggtttg
caaagtgtgattgatgaagtgcgcgaacgcatggcaaaagccgataatccgcctttatat
ttaagcttcgacattgatgcattagacccagcatttgcaccaggtacaggcacgccagaa
gttggcggattaaccactgcacaagccatgacattgctagaagcttggcacgatttgaac
tgggtaggcatggatttatgtgaagtatccccgccttatgatcatgctgaattaacttca
aatgcagccgcaactttaatgtggacatggctgtgcgggcgtattgttgcaaaaagaact
tag

DBGET integrated database retrieval system