KEGG   Methylotenera versatilis: M301_1082Help
Entry
M301_1082         CDS       T01247                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
meh  Methylotenera versatilis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M301_1082
Enzymes [BR:meh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     M301_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1212587..1213267
Genome map
AA seq 226 aa AA seqDB search
MQNKREQLLHISQQLVSLGLNRGTAGNVSVRADSAEGQAGFLITPSGLAVDKMASSDMVW
MDFSGNATGVHPPSSEWRFHRDILQQKSQVNAVIHTHSIYASTFSTFRKDMPPFHYMIAL
AGGDSIRCAPYALFGSQQLSDNAIEALKDRKACLLANHGMIAVGETLEKALDITQEVETL
CEQYLLALQVGEPYILSQQEMMDVLEKFKTYGAWSEASNGARAERR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaaacgagaacagctattacacatcagccaacagctggtaagtttgggcttg
aaccgcggaactgctggcaatgtcagtgtacgtgcagatagcgccgaggggcaagcaggt
tttttaatcacgccttcaggattggcggtcgataaaatggcatcttctgacatggtctgg
atggatttctcaggtaatgcgactggcgttcatcccccatcaagcgagtggcgattccat
agagatatattgcagcaaaaatcccaggtgaatgcggtgattcatactcacagtatctat
gccagtacattcagcacctttcgcaaagatatgccgccatttcactacatgattgcgctt
gctggcggcgatagtatacgttgtgcgccttatgctttgttcggcagtcagcagctttca
gataatgccatagaggcactaaaggaccgcaaagcttgtttgttagcaaatcatggcatg
attgctgtaggcgaaactttagaaaaggcgctcgacattactcaagaagtagaaacttta
tgcgagcaatatttactcgccttgcaagtcggtgagccgtacattttaagtcagcaagaa
atgatggatgtacttgaaaagttcaagacttatggtgcttggtctgaggcttccaatgga
gctcgtgctgagagaaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system