KEGG   Methylotenera versatilis: M301_1101Help
Entry
M301_1101         CDS       T01247                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
meh  Methylotenera versatilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_1101
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M301_1101
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M301_1101
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M301_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1230607..1232034
Genome map
AA seq 475 aa AA seqDB search
MKYISTRGQSPALSFSEILLGGLAPDGGLYLPEAYPQFTDADLTAMRGLSYADLAFAILS
RLVDDIPAADLKAIIDKTYRADVYAYTRAGQNAADITPTVKLEDNLYLLSLSNGPTLAFK
DMAMQLLGNLFEYVLTKEGKTTNILGATSGDTGSAAEYAMRGKKGIRVFMLSPHKKMSRF
QTAQMFSLQDDNIYNIAVNGVFDDCQDMVKAVSNDAEFKAKYKIGAVNSINWGRIIAQVV
YYFKGYFAVTSNNAQKVSFAVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLDEFFK
TGVYSPRGSANTYHTSSPSMDISKASNFERFVYDLVGRDGTKTRALWSKVDAGNSFDLNA
DGYFAKIADYGFQSGSSSHADRMKTIRETADKYQVIVDTHTADGIKVALELRDPNVPMVV
LETALPAKFEDSIVEALGKAPERPASLQGIESLPQKFTVMDASDAAIKNFIVKNT
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttctactcgcgggcagtcgcctgctttaagttttagcgaaattctacta
ggtggcttggcaccagatggtggtctttaccttccagaagcatatccacaatttactgat
gccgacttaacggcgatgcgtggcttgagttatgctgatttggcattcgcaattttgagc
cgtttggtagatgacattcctgcagctgatttaaaagcgattattgataaaacttatcgt
gcagatgtttatgcatacacccgagcagggcagaatgcggcagatattacgccaacagtt
aagcttgaagataacttgtatctgttgagcctttctaatggccctacgctagccttcaaa
gacatggcgatgcagttgctaggtaacctgtttgaatatgtgcttaccaaagaaggtaaa
accactaatattttaggcgcaacttctggcgacacaggttctgcggctgagtatgcaatg
cgtggtaaaaaaggcatacgcgtattcatgctttcacctcataaaaaaatgagccgcttt
caaactgcacaaatgttcagtttacaagacgacaacatttacaatattgctgtcaatggc
gtgtttgatgactgccaagacatggtgaaagcggtttcaaatgatgcggagtttaaagct
aaatacaaaatcggcgcggtaaactccattaactggggccgcattattgcccaagtggtg
tattactttaaaggctactttgccgtgacaagtaataatgctcaaaaagtcagctttgct
gtgcctagtggtaatttcggtaatgtttgtgcaggccatattgcgcgcatgatgggtttg
ccaattgataagttggtggttgctaccaatgaaaacgacgtgctagatgagttctttaaa
acaggcgtgtacagcccacgtggctcagccaatacttaccatacctctagcccttcaatg
gatatcagcaaagcctcaaactttgagcgttttgtttacgacttagtcggacgtgatggc
acaaaaactcgggcgctttggagcaaggtagatgcagggaatagctttgatttaaatgca
gatgggtattttgccaaaattgctgattacggttttcaatctggtagcagttcacatgct
gaccgcatgaaaaccattcgtgaaactgcagataaataccaagtgattgttgatacgcac
acagcggatggtattaaagtggcattagagcttcgtgatcctaatgtgcctatggtggtg
ctagaaacagccttgcctgccaagtttgaagattctattgtagaagctttaggcaaagca
cctgagcgtcctgcaagcttgcaaggcatagaaagcttaccgcagaaatttaccgtgatg
gatgcaagtgatgctgcaattaaaaattttatcgtaaaaaatacctag

DBGET integrated database retrieval system