KEGG   Methylotenera versatilis: M301_1178Help
Entry
M301_1178         CDS       T01247                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
meh  Methylotenera versatilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_1178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M301_1178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M301_1178
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M301_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1309901..1311103
Genome map
AA seq 400 aa AA seqDB search
MQLYDMPDARGHFGQFGGTFVAETLVEALEELRVMYEKYRHDPVFLAEYAYDLKHFVGRP
SPIYHAKRLSDKVGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKPRVIAETGAGQH
GVATATIAARLGLECVVYMGSEDVKRQAPNVFRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNVHNTFYIIGTVAGPHPYPMMVRDFQAVIGIEAKEQMMEMVGRQPDAVVACVGGGS
NAMGIFYPYIDVPNVRLIGVEAAGLGMETGKHAAPLTANSPVGVLHGNRTYLMQDVDGNI
IETHSVSAGLDYPGVGPEHAWLKDIKRAEYVAITDDEAMAAFHNLCRTEGIIPALESSHA
LAYAEKLAKTMSKDQIVLVNLSGRGDKDINTVAKLANITL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttatgatatgccagatgcacgtgggcactttggacaatttggcggtaccttt
gttgctgaaactttagttgaagcgctagaagagttacgtgtgatgtatgaaaaatacagg
cacgacccagtatttttagctgaatatgcttatgatttaaaacactttgttggccgtcca
agcccaatttatcatgcaaaacgattgtctgataaagttggtggtgcgcagatttatctg
aaacgtgaagatcttaaccatactggtgctcacaaaatcaacaacaccatcggccaagca
ttattggctaagcgtatgggtaaaccacgcgtgattgcagaaacaggtgctggtcagcat
ggagtagctacggcaacgattgctgcacgtttaggccttgagtgcgttgtttatatgggc
tctgaagacgttaaacgtcaagcgccaaacgtttttagaatgaaattgttaggtgcaacc
gtcgtgcctgttgaaagtggctctaaaacccttaaagatgcgcttaacgaggcgatgcgc
gactgggtgactaacgttcataacactttttatattatcggcacggtagcaggtccacat
ccatatcctatgatggtacgtgactttcaggctgtgattggcattgaagccaaagagcag
atgatggaaatggtgggtcgacagcccgatgccgtggtggcttgcgtaggtggtggctca
aatgcaatgggtattttttacccatatattgacgttccaaatgtgcgtttgataggcgta
gaagctgctggattaggtatggaaacaggtaaacacgcagcaccgttaacggcgaatagc
cctgtaggtgtattgcatggtaaccgtacttatttaatgcaagatgttgatggtaatatc
attgaaacgcactcggtttctgctggtttagattacccaggtgttggtccagaacatgct
tggttaaaagacatcaaacgtgctgaatacgttgcgattactgatgatgaagccatggcc
gcatttcataatctttgccgtacagaaggtattatcccagcattggaatctagccacgcg
cttgcttatgcagaaaagctcgctaaaacgatgagcaaagaccaaattgttctagtcaac
ttatcaggtcgtggtgataaagatattaataccgttgccaagctagctaacattactctt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system