KEGG   Methylotenera versatilis: M301_1178Help
Entry
M301_1178         CDS       T01247                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
meh  Methylotenera versatilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_1178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M301_1178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M301_1178
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M301_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1309901..1311103
Genome map
AA seq 400 aa AA seqDB search
MQLYDMPDARGHFGQFGGTFVAETLVEALEELRVMYEKYRHDPVFLAEYAYDLKHFVGRP
SPIYHAKRLSDKVGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKPRVIAETGAGQH
GVATATIAARLGLECVVYMGSEDVKRQAPNVFRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNVHNTFYIIGTVAGPHPYPMMVRDFQAVIGIEAKEQMMEMVGRQPDAVVACVGGGS
NAMGIFYPYIDVPNVRLIGVEAAGLGMETGKHAAPLTANSPVGVLHGNRTYLMQDVDGNI
IETHSVSAGLDYPGVGPEHAWLKDIKRAEYVAITDDEAMAAFHNLCRTEGIIPALESSHA
LAYAEKLAKTMSKDQIVLVNLSGRGDKDINTVAKLANITL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttatgatatgccagatgcacgtgggcactttggacaatttggcggtaccttt
gttgctgaaactttagttgaagcgctagaagagttacgtgtgatgtatgaaaaatacagg
cacgacccagtatttttagctgaatatgcttatgatttaaaacactttgttggccgtcca
agcccaatttatcatgcaaaacgattgtctgataaagttggtggtgcgcagatttatctg
aaacgtgaagatcttaaccatactggtgctcacaaaatcaacaacaccatcggccaagca
ttattggctaagcgtatgggtaaaccacgcgtgattgcagaaacaggtgctggtcagcat
ggagtagctacggcaacgattgctgcacgtttaggccttgagtgcgttgtttatatgggc
tctgaagacgttaaacgtcaagcgccaaacgtttttagaatgaaattgttaggtgcaacc
gtcgtgcctgttgaaagtggctctaaaacccttaaagatgcgcttaacgaggcgatgcgc
gactgggtgactaacgttcataacactttttatattatcggcacggtagcaggtccacat
ccatatcctatgatggtacgtgactttcaggctgtgattggcattgaagccaaagagcag
atgatggaaatggtgggtcgacagcccgatgccgtggtggcttgcgtaggtggtggctca
aatgcaatgggtattttttacccatatattgacgttccaaatgtgcgtttgataggcgta
gaagctgctggattaggtatggaaacaggtaaacacgcagcaccgttaacggcgaatagc
cctgtaggtgtattgcatggtaaccgtacttatttaatgcaagatgttgatggtaatatc
attgaaacgcactcggtttctgctggtttagattacccaggtgttggtccagaacatgct
tggttaaaagacatcaaacgtgctgaatacgttgcgattactgatgatgaagccatggcc
gcatttcataatctttgccgtacagaaggtattatcccagcattggaatctagccacgcg
cttgcttatgcagaaaagctcgctaaaacgatgagcaaagaccaaattgttctagtcaac
ttatcaggtcgtggtgataaagatattaataccgttgccaagctagctaacattactctt
taa

DBGET integrated database retrieval system