KEGG   Methylotenera versatilis: M301_1179Help
Entry
M301_1179         CDS       T01247                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
meh  Methylotenera versatilis
Pathway
meh00260  Glycine, serine and threonine metabolism
meh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01130  Biosynthesis of antibiotics
meh01230  Biosynthesis of amino acids
Module
meh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M301_1179
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M301_1179
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M301_1179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6 DUF561 PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: ADI29563
UniProt: D7DHM8
Position
1311124..1311927
Genome map
AA seq 267 aa AA seqDB search
MSRIQTVFTALKQQGKTALIPYITAGDPHPKHTVNLMRTLVKHGADMIELGVPFSDPMAD
GPVIQRASERALLHKVGLTAVLDMVKTFRETNQTTPIILMGYANPIEAIGATAFADRAKA
ADVDGVITVDYPPEECGDFVQQLRSRDIDPVFLLSPTTDQKRVDLIVNQASGFVYYVSLK
GVTGAANLDIAEVSQRVASIRKQTNLPVGVGFGIRDAATAKATAAIADAVVVGSRMVQTI
EASNDDNLLSNVATLMDELKTAVDAAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtattcaaacagtttttacagcacttaagcaacaaggcaaaacagctttaatt
ccatacatcacagcgggagatccacaccccaagcacaccgtgaatctaatgcgcactttg
gttaaacatggtgcagatatgatagagctaggtgtgccattttctgacccaatggcagat
ggcccagtaattcaacgtgcaagtgagcgtgctttactgcataaagtaggcctcacagcc
gtgctagatatggtcaaaacatttcgtgaaaccaatcaaacaacgccaattatactcatg
ggttatgctaatcctattgaagcaatcggcgctactgcatttgcagaccgcgcgaaagcg
gctgatgtggatggcgtgattactgtggattatccaccagaagaatgtggtgactttgtt
cagcagttacgttccagagatattgatcctgtatttttgttgtcaccaacaactgaccaa
aaacgtgtggatttaattgtgaaccaagccagtggctttgtttactatgtgtcactaaaa
ggcgttactggcgctgcgaatttggatattgctgaagtttcacaacgtgtcgcttcaatc
cgtaagcaaaccaatttgcctgtaggtgtaggttttggtattcgtgacgcagctacggca
aaagccacagctgcgattgcagatgctgtagttgttggtagtcgcatggtgcaaaccatt
gaggcctcaaatgatgataatttgttgagcaatgtggcgacattaatggacgaacttaaa
accgcagtggatgctgcaaaataa

DBGET integrated database retrieval system