KEGG   Methylotenera versatilis: M301_1179Help
Entry
M301_1179         CDS       T01247                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
meh  Methylotenera versatilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M301_1179
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M301_1179
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M301_1179
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M301_1179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1311124..1311927
Genome map
AA seq 267 aa AA seqDB search
MSRIQTVFTALKQQGKTALIPYITAGDPHPKHTVNLMRTLVKHGADMIELGVPFSDPMAD
GPVIQRASERALLHKVGLTAVLDMVKTFRETNQTTPIILMGYANPIEAIGATAFADRAKA
ADVDGVITVDYPPEECGDFVQQLRSRDIDPVFLLSPTTDQKRVDLIVNQASGFVYYVSLK
GVTGAANLDIAEVSQRVASIRKQTNLPVGVGFGIRDAATAKATAAIADAVVVGSRMVQTI
EASNDDNLLSNVATLMDELKTAVDAAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtattcaaacagtttttacagcacttaagcaacaaggcaaaacagctttaatt
ccatacatcacagcgggagatccacaccccaagcacaccgtgaatctaatgcgcactttg
gttaaacatggtgcagatatgatagagctaggtgtgccattttctgacccaatggcagat
ggcccagtaattcaacgtgcaagtgagcgtgctttactgcataaagtaggcctcacagcc
gtgctagatatggtcaaaacatttcgtgaaaccaatcaaacaacgccaattatactcatg
ggttatgctaatcctattgaagcaatcggcgctactgcatttgcagaccgcgcgaaagcg
gctgatgtggatggcgtgattactgtggattatccaccagaagaatgtggtgactttgtt
cagcagttacgttccagagatattgatcctgtatttttgttgtcaccaacaactgaccaa
aaacgtgtggatttaattgtgaaccaagccagtggctttgtttactatgtgtcactaaaa
ggcgttactggcgctgcgaatttggatattgctgaagtttcacaacgtgtcgcttcaatc
cgtaagcaaaccaatttgcctgtaggtgtaggttttggtattcgtgacgcagctacggca
aaagccacagctgcgattgcagatgctgtagttgttggtagtcgcatggtgcaaaccatt
gaggcctcaaatgatgataatttgttgagcaatgtggcgacattaatggacgaacttaaa
accgcagtggatgctgcaaaataa

DBGET integrated database retrieval system