KEGG   Methylotenera versatilis: M301_1224Help
Entry
M301_1224         CDS       T01247                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
meh  Methylotenera versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:meh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1363708..1364538
Genome map
AA seq 276 aa AA seqDB search
MPICLVPRNCTLKNKTIAILENRAGEQLADLVRKYGGTPLSAPALAEIPDIDPALITSLI
NDWQINAPDIFIFQTGVGVKALFATTDTLGITEQLKQILESSIVIVRGIKPSSALRSYKV
RIDATAGDPFTTTEVLTELDKYKIKGKRVAVQRYGDVNLELQQALDTRGAIVTEIATYRW
SLPADTQPLVDLMDALDAGKVDMVCFTSASQVYNFFTVAEALGRHQALLAALNKSMVASI
GPVCTVALNKFGIKVDVEPQPPKLGPFITAINSKFA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctatctgtctagtacctaggaattgtacattgaaaaataaaaccattgccatttta
gaaaaccgtgcaggtgagcaacttgccgacttggtgagaaagtatggcggtacgccactt
tctgcgccagcattggcagaaattcctgatattgaccctgcattaattactagcttaatc
aacgactggcagataaatgcgccagacatctttatttttcaaacaggcgttggtgttaaa
gctttatttgctaccactgacacattaggcattaccgagcagcttaagcagattcttgaa
tcctcaattgtgattgtgagaggcattaaaccgtcgtcagcattgcgctcatataaagta
aggatagatgcgactgcgggtgatccatttacaacaacggaagtgctgactgagttagat
aaatacaagattaaaggcaaacgagtggcggtccaacgatatggcgatgtcaacttggaa
cttcagcaagccctagacacaagaggtgctatagtcactgagattgccacctaccgctgg
agcttgcccgcagatacgcaaccgctggttgacttaatggatgcgttagatgctggaaaa
gttgatatggtgtgttttactagtgcatcgcaagtttataacttctttaccgtagcagaa
gcacttggtcgccaccaagcattgctggcagcgcttaataaaagcatggtggcttctatt
ggccctgtgtgcactgttgcattaaataaatttggcatcaaagtcgatgttgagccacaa
cctcccaagctaggtccgtttattacggctattaatagcaagtttgcttaa

DBGET integrated database retrieval system