KEGG   Methylotenera versatilis: M301_1224Help
Entry
M301_1224         CDS       T01247                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
meh  Methylotenera versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M301_1224
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     M301_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1363708..1364538
Genome map
AA seq 276 aa AA seqDB search
MPICLVPRNCTLKNKTIAILENRAGEQLADLVRKYGGTPLSAPALAEIPDIDPALITSLI
NDWQINAPDIFIFQTGVGVKALFATTDTLGITEQLKQILESSIVIVRGIKPSSALRSYKV
RIDATAGDPFTTTEVLTELDKYKIKGKRVAVQRYGDVNLELQQALDTRGAIVTEIATYRW
SLPADTQPLVDLMDALDAGKVDMVCFTSASQVYNFFTVAEALGRHQALLAALNKSMVASI
GPVCTVALNKFGIKVDVEPQPPKLGPFITAINSKFA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctatctgtctagtacctaggaattgtacattgaaaaataaaaccattgccatttta
gaaaaccgtgcaggtgagcaacttgccgacttggtgagaaagtatggcggtacgccactt
tctgcgccagcattggcagaaattcctgatattgaccctgcattaattactagcttaatc
aacgactggcagataaatgcgccagacatctttatttttcaaacaggcgttggtgttaaa
gctttatttgctaccactgacacattaggcattaccgagcagcttaagcagattcttgaa
tcctcaattgtgattgtgagaggcattaaaccgtcgtcagcattgcgctcatataaagta
aggatagatgcgactgcgggtgatccatttacaacaacggaagtgctgactgagttagat
aaatacaagattaaaggcaaacgagtggcggtccaacgatatggcgatgtcaacttggaa
cttcagcaagccctagacacaagaggtgctatagtcactgagattgccacctaccgctgg
agcttgcccgcagatacgcaaccgctggttgacttaatggatgcgttagatgctggaaaa
gttgatatggtgtgttttactagtgcatcgcaagtttataacttctttaccgtagcagaa
gcacttggtcgccaccaagcattgctggcagcgcttaataaaagcatggtggcttctatt
ggccctgtgtgcactgttgcattaaataaatttggcatcaaagtcgatgttgagccacaa
cctcccaagctaggtccgtttattacggctattaatagcaagtttgcttaa

DBGET integrated database retrieval system