KEGG   Methylotenera versatilis: M301_1474Help
Entry
M301_1474         CDS       T01247                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
meh  Methylotenera versatilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:meh01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:meh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1636452..1637396
Genome map
AA seq 314 aa AA seqDB search
MLKKIIKWFDNEAVIIPEDGLSYRANWRQIDLWRVIPFVLLHLACFAVFWVEFSWFALVF
AIALYAIRMFAITGFYHRYFSHKAFRTTRVFQFILAVFGATAVQRGPLWWASHHRHHHIK
SDEIDDAHSPVQHGFLWSHLGWFLSNKHFATQTERVKELAKFAELRLLDRFDIVVPILFG
LSIYLLGVWLESYYPNLNTNGMQLLVWGFAISTVVLYHATFTVNSLAHVWGKRRYATSDQ
SRNNLWIALLTLGEGWHNNHHHYPGSARQGFYWWEIDLTFYGLKLLAACGLIWDVRTVPT
AIRESKKINRTISR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaagattattaaatggtttgataatgaagccgtgattatccccgaggatggt
ctgagctatcgcgcaaactggcgccaaattgatttgtggcgcgtgattccatttgtgtta
ttacatttagcttgcttcgcagttttttgggtcgaatttagctggtttgcactggttttt
gccattgcactttatgccattagaatgtttgcaatcactggtttttaccatcgttatttt
tcacacaaggcttttcgcaccacacgtgttttccagtttattctagctgtgttcggcgcc
actgcagtgcagcgcggccctttgtggtgggcttcgcatcataggcatcaccatattaaa
tcagatgaaatagacgatgcgcactcccctgtgcaacatggatttttatggagtcacttg
ggctggtttctttcaaacaaacacttcgccacacaaactgagcgcgtcaaagagctggct
aagtttgcagaattacgtttactcgatcgttttgatatcgttgtaccaattctttttggc
ctgagtatttacttattaggcgtatggcttgagagctattacccaaacctgaacaccaat
ggcatgcaattgctggtctgggggtttgctatatctaccgtagtgttatatcacgccaca
ttcacggtgaactcgctcgcacacgtttggggcaagcgtcgctatgcaactagcgatcaa
agccgcaataacctatggattgcattgttaaccttaggcgaaggctggcataacaaccat
catcactaccctggctctgcgcgacaaggtttttattggtgggaaatagacttaacgttt
tatggcttaaagctacttgcagcctgcgggttaatatgggacgtcagaactgttcccaca
gctatccgcgaatcaaaaaaaataaatagaacaatcagtcgttaa

DBGET integrated database retrieval system