KEGG   Methylotenera versatilis: M301_1496Help
Entry
M301_1496         CDS       T01247                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M301_1496
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_1496
   00052 Galactose metabolism
    M301_1496
   00500 Starch and sucrose metabolism
    M301_1496
   00520 Amino sugar and nucleotide sugar metabolism
    M301_1496
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M301_1496
   00524 Butirosin and neomycin biosynthesis
    M301_1496
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M301_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1666373..1667326)
Genome map
AA seq 317 aa AA seqDB search
MTVLIGIDVGGTNLRLGVVDYDETTPNIPPRLIEEKRFQTDFSNMCKIHTPEQAWRAILN
ATAAAIDSMHVKYPNISAVGIGFPGFIDPHTQKISQSPNLPGLVDVDLSADLSQLIELPV
MTENDALAAAYGEYVTRASQINHLIYLGLGTGVGGGLILNGQPFQGQHGVAMEVGHMSVH
PNGRLCGCGNYGCMEQYASASGVAISYLEATGQQYNSHEIARLAHQGDTHAISAYSLAGK
ALAQALAQVLKVIDVTNVVIGGGMSAAWSLIEPAFAQQLNEDLIPALRGNVNLSISSMGD
QAGIIGAAMLVQKKFII
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattaattggtatcgatgttggcggtacaaatctacgtttgggcgtagtggat
tatgatgaaactacgcctaacattcctcctcgcttaatagaggaaaaacgctttcaaact
gatttttctaatatgtgtaaaattcacacgccagagcaagcatggcgagccattttaaat
gcgacagcagcggcaatagatagtatgcatgtgaagtatcccaatatatcggccgttggc
ataggctttccaggttttatcgatccgcatacgcaaaaaatttcgcaatctcccaatttg
cccggtttagttgacgtagatttaagtgccgatttaagtcagctgatagagctgcctgtc
atgacggaaaacgatgcattagctgcagcctacggagagtatgtcacgcgtgctagtcaa
atcaatcatctcatttatttgggattgggcacaggtgttggtggtggtttgattttaaat
ggccagccgtttcaaggtcagcatggcgtggctatggaagttgggcatatgtctgttcat
ccgaatggtagattatgcggctgcggcaattatggctgcatggaacaatatgcctcagcc
agtggggttgcaattagctatttagaagcaactggtcaacaatataactcacacgaaatt
gcacgccttgctcatcagggtgacacacatgctatttctgcctattctttagcgggtaaa
gcacttgctcaggcattggcacaggttttaaaagtaatcgacgtgaccaatgtagtgata
ggggggggcatgagtgccgcttggtcgcttatagagccagcctttgcacagcagttaaac
gaagatttgattccagctttacgtggtaacgtgaatctaagtatctctagcatgggtgac
caagcaggtattattggtgccgccatgttggtgcaaaaaaaattcattatttaa

DBGET integrated database retrieval system