KEGG   Methylotenera versatilis: M301_1496Help
Entry
M301_1496         CDS       T01247                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
meh  Methylotenera versatilis
Pathway
meh00010  Glycolysis / Gluconeogenesis
meh00052  Galactose metabolism
meh00500  Starch and sucrose metabolism
meh00520  Amino sugar and nucleotide sugar metabolism
meh00521  Streptomycin biosynthesis
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01120  Microbial metabolism in diverse environments
meh01130  Biosynthesis of antibiotics
meh01200  Carbon metabolism
Module
meh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_1496
   00052 Galactose metabolism
    M301_1496
   00500 Starch and sucrose metabolism
    M301_1496
   00520 Amino sugar and nucleotide sugar metabolism
    M301_1496
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M301_1496
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    M301_1496
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M301_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADI29876
UniProt: D7DIJ1
Position
complement(1666373..1667326)
Genome map
AA seq 317 aa AA seqDB search
MTVLIGIDVGGTNLRLGVVDYDETTPNIPPRLIEEKRFQTDFSNMCKIHTPEQAWRAILN
ATAAAIDSMHVKYPNISAVGIGFPGFIDPHTQKISQSPNLPGLVDVDLSADLSQLIELPV
MTENDALAAAYGEYVTRASQINHLIYLGLGTGVGGGLILNGQPFQGQHGVAMEVGHMSVH
PNGRLCGCGNYGCMEQYASASGVAISYLEATGQQYNSHEIARLAHQGDTHAISAYSLAGK
ALAQALAQVLKVIDVTNVVIGGGMSAAWSLIEPAFAQQLNEDLIPALRGNVNLSISSMGD
QAGIIGAAMLVQKKFII
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattaattggtatcgatgttggcggtacaaatctacgtttgggcgtagtggat
tatgatgaaactacgcctaacattcctcctcgcttaatagaggaaaaacgctttcaaact
gatttttctaatatgtgtaaaattcacacgccagagcaagcatggcgagccattttaaat
gcgacagcagcggcaatagatagtatgcatgtgaagtatcccaatatatcggccgttggc
ataggctttccaggttttatcgatccgcatacgcaaaaaatttcgcaatctcccaatttg
cccggtttagttgacgtagatttaagtgccgatttaagtcagctgatagagctgcctgtc
atgacggaaaacgatgcattagctgcagcctacggagagtatgtcacgcgtgctagtcaa
atcaatcatctcatttatttgggattgggcacaggtgttggtggtggtttgattttaaat
ggccagccgtttcaaggtcagcatggcgtggctatggaagttgggcatatgtctgttcat
ccgaatggtagattatgcggctgcggcaattatggctgcatggaacaatatgcctcagcc
agtggggttgcaattagctatttagaagcaactggtcaacaatataactcacacgaaatt
gcacgccttgctcatcagggtgacacacatgctatttctgcctattctttagcgggtaaa
gcacttgctcaggcattggcacaggttttaaaagtaatcgacgtgaccaatgtagtgata
ggggggggcatgagtgccgcttggtcgcttatagagccagcctttgcacagcagttaaac
gaagatttgattccagctttacgtggtaacgtgaatctaagtatctctagcatgggtgac
caagcaggtattattggtgccgccatgttggtgcaaaaaaaattcattatttaa

DBGET integrated database retrieval system