KEGG   Methylotenera versatilis: M301_1497Help
Entry
M301_1497         CDS       T01247                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
meh  Methylotenera versatilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:meh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1667345..1668865)
Genome map
AA seq 506 aa AA seqDB search
MKRTNLSLLSQRRSGVLLHISSLPSSPDAHDFGVGDLGAEAYRFVDFLSRIGVSVWQTLP
INMPHADNSPYQCLSAFAGNPDFISLERLQSQGLLNQKDLTGESISKADLIATAYEVFRE
QAKQVESLAEKEQLNFKKFCKKQARWLNDFALFLALRHKFNLAGWQYWPDGYKNRDVATL
KQARKELAHEITIIQFTQFVFFTQWLALKAYAATKNVYLFGDIPIFVAYDSADVWAQPHF
FKLDDYKNMEVVAGVPPDYFCATGQRWGNPHYNWDAMAADNFSWWVSRMATQNALFDIVR
IDHFRGLQAAWEIPASEDTAINGQWVLAPGEALLAAIFKALPKICLVAEDLGIITPEVDA
LRHQYDLPGMKILQFAFSGQDDNPYLPHHIEASSVAYTGTHDNDTTLGWYNSLDDSQRGH
VQAYIYSSRSEEHDVHMPADLINLVFESHAQLAIIPMQDILALDSSHRMNTPGTCSGNWH
WRFNWQQLILAQEESITEVITRTARS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactaatttatctcttttatctcaacgccgatcaggggtgttgttacacatt
agctctttgcctagctcccctgacgcgcatgatttcggggtaggtgatttaggcgcagag
gcttaccgctttgtagatttcttaagtagaattggcgtaagcgtttggcaaacattgcca
atcaatatgccacatgcagataactctccttatcagtgtttatcagcctttgcgggcaat
cctgattttattagtcttgaaagactacaatcacaaggcttgcttaatcaaaaggattta
actggcgagtcaatcagtaaagccgatttgattgcaacagcctatgaggtatttcgagag
caagccaagcaggtagagtctttggcagagaaagagcagctcaatttcaaaaagttttgt
aaaaaacaagcacgctggctgaatgattttgccttatttttagcattacgtcataagttt
aatctggctggctggcaatattggcctgatggctataaaaacagagatgttgcaacgctt
aagcaggcacgtaaagaactggcacatgaaatcactattatccagtttacccagtttgta
ttttttacccagtggctagcactcaaagcttatgctgcgactaaaaacgtttatttattt
ggtgacattccaatttttgttgcgtatgacagtgcagatgtttgggcgcagccgcacttc
tttaagttagatgattataaaaatatggaggtggtggcaggcgtgccgccagattacttc
tgcgctacaggtcagcgttggggtaacccacactataactgggatgcaatggcggccgat
aattttagctggtgggtttcgcgcatggcaacacaaaacgccttgtttgacattgtacgc
attgaccattttagaggcttgcaagctgcttgggagattcctgcaagtgaagatacggca
attaatggtcaatgggtattagcgccgggtgaagctttactggcagccatttttaaagcc
ttacctaagatttgtttagttgcagaagacttgggcattattacgccagaagtggatgca
ctaaggcatcaatacgacttgccgggtatgaagattctgcagtttgcgtttagtggtcaa
gatgataatccctatttgccgcatcacatcgaagctagtagtgtggcttatacaggtacg
cacgataatgacacaacacttggttggtataacagtttagatgatagtcagcgtggtcat
gtgcaggcttatatatattcttcacgttctgaggaacatgatgtacacatgccagctgac
ttgattaaccttgtgtttgagtctcatgcacaattagcgattattccaatgcaagatata
ttggcgctggattctagtcaccgtatgaataccccaggcacgtgctctggcaattggcat
tggcgttttaattggcaacagttaatattagctcaggaagaaagtattactgaagtgatt
actcggacggcaagaagttaa

DBGET integrated database retrieval system