KEGG   Methylotenera versatilis: M301_1500Help
Entry
M301_1500         CDS       T01247                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
meh  Methylotenera versatilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:meh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1672224..1674482
Genome map
AA seq 752 aa AA seqDB search
MDKSEATPVDSTTKVAAKTSAKAKSASNANSDSLKLILKAKHHDPFSFLGLHAVENTYVY
RVFLPSASEVWVKNSRTWTKLNKTHADGLFEVASETAIKTPCLLKVSAGGSEYETYDPYT
FSSSLTQDELYLFGEGRLLQGYKTLGAQCLSQKNIEGVRFAVWAPNAERVSVIGSFNNWD
GRVHSMRAHGSSGVWDIFIPHLTTNDTYKFEIRNRHTGHILAKTDPYGFEFEPRPGTAAK
ISTSQHQWQDKNWLDARQKRDWLHAPFNCYEVHLGSWQRNEQGHFLTYRELANTLVPYVT
EMGYTHVELMPISEHPLTESWGYQTTGYFGVTNRFGSPDDLRFLIDAFHQANIGVILDWV
PGHFPKDDWALARFDGTALYEHEDPRLGEHQDWGTLIFNYGRNEVRNFLMSNAYFWLSEF
HIDGLRVDAVASMLYLDYSRKAGEWLPNKFGGRENLDVIDFLKQLNVMVGEDFAGVLTIA
EESTAWPGVSRPVYLGGLGFNMKWNMGWMNDTLSYIEHDPVHRRYYHDMLTFGQLYAYSE
NFVLPFSHDEVVHGKHSLLDKMPGDAWQKFANLRLLITYQMTTPGKKLNFMGNEFGQGRE
WNVNSSLDWHLLGKDYEGHQWHQGVKQATTDLNKIYKDVNALHALDFEVQGFEWIDCHDS
DQSIVSYIRRGLDNSFVIIVLNFTPVLRNAYRIGVPQAGNYHEIFNSDAGCYGGSNQGNG
SGLHTENVAWMNHQQSLVITLPPLAGIVLQLN
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
ttggataaatctgaagcgactccagttgattcaacaaccaaagtagccgcaaaaacaagc
gctaaagccaagtcagcttcaaacgcaaattcagattctttgaaactgattttaaaagca
aaacatcacgatccatttagctttttaggtttacatgctgttgaaaacacctatgtttac
cgtgtgttcctgccaagcgcctctgaagtttgggttaaaaactccagaacatggactaag
ctcaataaaacacatgcggatggtttatttgaggtggctagcgaaaccgctatcaaaacg
ccctgtttgcttaaagtaagtgctggtggtagcgagtacgaaacctatgacccctacaca
ttttcatcaagcctgacgcaagatgagctttacttgtttggcgaaggccgcttattacag
ggctataaaacattaggcgcgcagtgcctctctcaaaaaaatatcgagggcgtacgattt
gccgtatgggcacctaatgctgaacgcgtcagcgtgattggtagctttaacaattgggat
ggtcgagtacactccatgcgcgcgcatggctctagcggcgtttgggatatttttatccca
catttaacaacgaatgacacctataaatttgaaattcgcaatcgtcacactggtcacatt
ttagctaaaactgacccctatggttttgagtttgagccacgcccaggaactgctgcaaaa
atcagcacgagtcagcatcaatggcaagataaaaactggctagatgcacgtcaaaaacgt
gattggctgcatgcaccattcaactgctatgaggtgcatctcggttcatggcagcgtaac
gaacaaggtcattttttaacgtatcgtgaactcgcaaatacgctggtaccttacgtcact
gaaatgggctacacccacgttgaattgatgccaatttcagagcacccgctcacagagtct
tggggttatcaaacgacaggttattttggcgtgactaaccgatttggctcaccagatgat
ttacgctttttgattgatgcatttcatcaagccaatattggcgtgattttagattgggtg
ccgggtcattttccaaaagatgattgggcattagcaaggttcgatggcactgcgctatat
gagcacgaagatccacgtctaggtgaacaccaagactggggaacgttgattttcaattac
ggccgcaatgaagtgcgtaactttttgatgtctaacgcttatttctggctgtctgaattc
catatagatggtttacgcgtagatgctgtagcctcaatgctatatctagattactcacgt
aaagcaggtgaatggttgccaaacaaatttggtgggcgagaaaatctagatgttatcgac
ttcctaaaacaactcaatgtcatggttggcgaagactttgctggcgttctaactatcgct
gaagaatctaccgcatggcctggcgtatctcgcccagtgtacttaggtggtttgggcttc
aacatgaaatggaatatgggatggatgaatgacaccctttcatatatcgagcatgaccca
gtacacagacgttattatcacgacatgctgacttttggtcagctgtacgcctattctgaa
aactttgtgctgcccttctcacatgatgaagtagtacacggtaaacattcgctgttagac
aaaatgcccggcgacgcatggcaaaaatttgccaatttgcgtctgttgattacttatcaa
atgacaacccctggtaaaaaactcaatttcatgggtaatgaatttggtcaaggacgtgag
tggaatgtcaacagtagccttgattggcacttgctaggcaaagactatgaaggtcatcaa
tggcatcaaggtgttaagcaagcaacaactgatttaaataaaatttataaggacgtcaat
gcattgcatgcgcttgattttgaagtgcaaggctttgaatggatagactgtcatgacagc
gatcaatcaatagttagctatattcgacggggtttagacaatagttttgttataatagtg
ctgaattttacacctgtgttgcgaaatgcatatcgcattggcgtaccgcaagcgggtaat
tatcatgagatttttaacagtgacgctggttgctatggcggtagcaatcaaggtaatggc
tctggcttgcatacagaaaatgttgcttggatgaatcatcaacaatcacttgtcatcaca
ttgccacctttagcaggtatcgttttacaattaaactaa

DBGET integrated database retrieval system