KEGG   Methylotenera versatilis: M301_1560Help
Entry
M301_1560         CDS       T01247                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
meh  Methylotenera versatilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    M301_1560
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M301_1560
Enzymes [BR:meh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M301_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1745114..1745644)
Genome map
AA seq 176 aa AA seqDB search
MKKTLISALLFGASHMANAACLDLYNHQLTTLQGEKINLCDYQDKPILVVNTASKCGFTP
QFEALESLYSQYKSKGLLVIGFPSNDFRQEPGNDKQIGDFCKLTYAVKFPMMTKSSVTGA
NANPFYKQLIAKTGQEPQWNFYKYVILPGGKNVYAYSSEVTPESAEILGKIKPGLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactctaatttcagctctactatttggagcatcacatatggctaatgctgct
tgtttagatctttacaaccatcaactcacaacgttgcaaggcgagaaaataaatctgtgt
gattatcaggataagcctattttagtcgtgaacacggcgagtaaatgtggtttcacacca
cagtttgaagcgcttgaaagtttgtatagccaatataaaagcaaaggcttgttggtgata
ggttttccttctaatgattttaggcaagagcctgggaacgataagcaaatcggtgatttc
tgcaaattaacttatgcggtgaagtttcctatgatgactaaaagctctgttacaggtgca
aatgccaacccattttataagcagttaatcgctaaaacaggccaagagccgcaatggaat
ttttataaatatgtgattctgccaggtggtaaaaatgtgtacgcttacagtagcgaagta
acaccagagtccgctgagattttaggtaagataaaaccaggtttgaaataa

DBGET integrated database retrieval system