KEGG   Methylotenera versatilis: M301_1568Help
Entry
M301_1568         CDS       T01247                                 

Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
meh  Methylotenera versatilis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:meh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1752147..1753427)
Genome map
AA seq 426 aa AA seqDB search
MLDIQALRTDLDGVVSQLKARGFEFDSASFTTLENERKTVQTRTQELQAKRNNTSKQIGI
AKSKGEDVSAIMAEVAGFGDQLKADEARLIELQASLQNLLLNVPNLPHSSVPSGKSEADN
IEVRKVGTPRTFDFEVKDHADVGTPLGLDFDTGTKLSGTRFTLMRGQIAKMHRALAQFML
NTQTEQHGYEECYTPYLVNAETLTGTGQLPKFEEDLFSLQHNDSKLYLIPTSEVTLTNTV
RDEIVPLESLPIKLTAHTPCFRSEAGSYGRDTKGMIRQHQFDKVEMVQIVHPDTSYAALE
EMVGHAENILKALGLPYRVVSLCTGDMGFGAAKTYDLEVWLPAQNTYREISSVSNCEAFQ
ARRLQARFRNENGKPELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYMNGLE
KLTISK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttagatatacaagcgttaagaactgatttggacggcgttgttagccaattaaaagcg
cgtggatttgagtttgattcagccagttttacaaccttagaaaacgagcgtaaaaccgta
caaactcgcacgcaagagctacaagctaaacgtaataacacctctaaacaaatcggcatc
gctaaatctaaaggtgaagacgtgagcgccatcatggcagaagttgcgggcttcggtgac
caattaaaagccgatgaagcacgattgattgagttgcaagctagcttacagaacttactg
ctaaatgtaccaaatctaccgcattcaagcgtgccatcaggaaaatcagaggctgataac
atagaagtgcgtaaagttggaacgccgcgtacatttgattttgaagtgaaagatcatgcc
gatgtcggcacgccattaggtttggatttcgatactggtactaagctttcaggcacgcgt
tttaccttaatgcgtggacaaatcgcaaaaatgcatcgtgctttagcgcagtttatgttg
aatactcaaactgaacaacatggctatgaggaatgctatacgccgtatttggtgaacgca
gaaacgctaacgggtactggtcagttgccaaagtttgaagaagatttattcagcttacag
cacaatgacagtaagctttatctaatcccaacatcagaagttacactcaccaatacagta
cgcgatgaaatcgtacctttagaatcattgccaatcaagctaacagcgcacacgccttgc
ttccgttctgaagcaggttcttatggtcgcgatactaaaggcatgatacgtcagcatcag
tttgataaagtcgagatggtgcaaatcgtacatcctgataccagttatgcagcgcttgaa
gagatggtagggcatgcggaaaatatcttgaaagcgctaggcttaccatatcgtgtggtt
tcactctgcacaggtgatatgggttttggcgcagctaaaacttacgatttagaagtgtgg
ctgcctgcacaaaatacttatcgtgagatttcatctgtttcaaactgcgaagcatttcaa
gcacggcgtttacaagcacgttttagaaacgaaaacggcaaacccgagttagtgcatacg
ctgaatggttctggtttggcagtagggcgtaccttggtggcagtgctagaaaattatcaa
aatgcagatggtagcgtgaccgtgccagaggtattaagaccatacatgaacggtttagaa
aagctgactatttctaaataa

DBGET integrated database retrieval system