KEGG   Methylotenera versatilis: M301_1568Help
Entry
M301_1568         CDS       T01247                                 

Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
meh  Methylotenera versatilis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:meh00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    M301_1568
Enzymes [BR:meh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     M301_1568
Amino acid related enzymes [BR:meh01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   M301_1568
Transfer RNA biogenesis [BR:meh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    M301_1568
 Prokaryotic Type
    M301_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1752147..1753427)
Genome map
AA seq 426 aa AA seqDB search
MLDIQALRTDLDGVVSQLKARGFEFDSASFTTLENERKTVQTRTQELQAKRNNTSKQIGI
AKSKGEDVSAIMAEVAGFGDQLKADEARLIELQASLQNLLLNVPNLPHSSVPSGKSEADN
IEVRKVGTPRTFDFEVKDHADVGTPLGLDFDTGTKLSGTRFTLMRGQIAKMHRALAQFML
NTQTEQHGYEECYTPYLVNAETLTGTGQLPKFEEDLFSLQHNDSKLYLIPTSEVTLTNTV
RDEIVPLESLPIKLTAHTPCFRSEAGSYGRDTKGMIRQHQFDKVEMVQIVHPDTSYAALE
EMVGHAENILKALGLPYRVVSLCTGDMGFGAAKTYDLEVWLPAQNTYREISSVSNCEAFQ
ARRLQARFRNENGKPELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYMNGLE
KLTISK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttagatatacaagcgttaagaactgatttggacggcgttgttagccaattaaaagcg
cgtggatttgagtttgattcagccagttttacaaccttagaaaacgagcgtaaaaccgta
caaactcgcacgcaagagctacaagctaaacgtaataacacctctaaacaaatcggcatc
gctaaatctaaaggtgaagacgtgagcgccatcatggcagaagttgcgggcttcggtgac
caattaaaagccgatgaagcacgattgattgagttgcaagctagcttacagaacttactg
ctaaatgtaccaaatctaccgcattcaagcgtgccatcaggaaaatcagaggctgataac
atagaagtgcgtaaagttggaacgccgcgtacatttgattttgaagtgaaagatcatgcc
gatgtcggcacgccattaggtttggatttcgatactggtactaagctttcaggcacgcgt
tttaccttaatgcgtggacaaatcgcaaaaatgcatcgtgctttagcgcagtttatgttg
aatactcaaactgaacaacatggctatgaggaatgctatacgccgtatttggtgaacgca
gaaacgctaacgggtactggtcagttgccaaagtttgaagaagatttattcagcttacag
cacaatgacagtaagctttatctaatcccaacatcagaagttacactcaccaatacagta
cgcgatgaaatcgtacctttagaatcattgccaatcaagctaacagcgcacacgccttgc
ttccgttctgaagcaggttcttatggtcgcgatactaaaggcatgatacgtcagcatcag
tttgataaagtcgagatggtgcaaatcgtacatcctgataccagttatgcagcgcttgaa
gagatggtagggcatgcggaaaatatcttgaaagcgctaggcttaccatatcgtgtggtt
tcactctgcacaggtgatatgggttttggcgcagctaaaacttacgatttagaagtgtgg
ctgcctgcacaaaatacttatcgtgagatttcatctgtttcaaactgcgaagcatttcaa
gcacggcgtttacaagcacgttttagaaacgaaaacggcaaacccgagttagtgcatacg
ctgaatggttctggtttggcagtagggcgtaccttggtggcagtgctagaaaattatcaa
aatgcagatggtagcgtgaccgtgccagaggtattaagaccatacatgaacggtttagaa
aagctgactatttctaaataa

DBGET integrated database retrieval system