KEGG   Methylotenera versatilis: M301_1658Help
Entry
M301_1658         CDS       T01247                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M301_1658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_1658
   00620 Pyruvate metabolism
    M301_1658
   00640 Propanoate metabolism
    M301_1658
  Energy metabolism
   00680 Methane metabolism
    M301_1658
Enzymes [BR:meh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M301_1658
Lipid biosynthesis proteins [BR:meh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M301_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1859434..1861422
Genome map
AA seq 662 aa AA seqDB search
MSIESVLHENRVFEPSADFVKNANVSGMSAYNALCKEATDDFQGFWAKLARELLVWNKPF
TKTLNEDNAPFYKWFEDGELNVSANCLDKHLNTIPNKVAIIFEADDGSVTNVTFKELYHR
VCQFANGLKKLNLTVGDRVIIYLPMGIDAVVAMQACARLGLTHSVVFGGFSAKSLNERII
DAGAVAVITSDGQFRGGKALPLKPAVDEGIAMGGCESIKNVVVLKKTGQEITWNQNGNAN
NIWWHDLIAGQADTCEPVMLSAEHPLFLLYTSGSTGKPKGVQHSSAGYLLHAMNSMRWTF
DVKDNDVFWCTADVGWITGHTYVAYGPLAMGVTQVVFEGIPTYPDAGRFWQMIQKHKVSI
FYTAPTAIRSLIKASETTASTHPKSYDLSSLRLLGSVGEPINPEAWMWYYENVGGGHCPI
VDTFWQTETGGHVITPLPGATSLVPGSCTLPFPGIDIDVVDETGKDVPWGTGGLLVIKKP
WPSMIRTIYNDPERYKSSYYPVDLGGKIYLAGDGAVRDAKTGNFTIMGRIDDVLNVSGHR
LGTMEIESALVSNPLVAEAAVVGKPHDIKGESVVAYVVLKGQRPEGEELKKIVAQLRDWV
GKEIGPIAKPDEIRFGDNLPKTRSGKIMRRLLRSLAKGEEITSDISTLDNPAILDQLKEV
VK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgagtcagttcttcatgaaaaccgcgtatttgaacctagcgcagattttgta
aaaaatgccaatgtctctggcatgtcagcctacaacgctttatgcaaagaggcaaccgac
gatttccaaggcttttgggcgaaattggcgcgtgagctgttagtttggaataaacccttc
actaaaacacttaacgaagataacgccccgttttacaaatggtttgaagatggtgaactg
aatgtttcagcaaactgcttagataaacacctgaatactattcctaacaaagttgcgatt
atttttgaagccgatgacggcagcgtcactaacgtgacctttaaagagttgtatcaccgc
gtttgtcagtttgctaatggcttaaaaaagctaaacctcaccgtgggcgatcgtgtgatt
atttatttaccaatgggtattgatgccgtagtggcaatgcaagcttgtgcacgtttaggt
ttaacacactctgtggtgttcggcggtttttcagctaaaagcttaaatgaacgtattatt
gatgctggtgctgtggccgtgattacttctgatggtcaatttcgcggcggtaaagcactg
ccactaaaacctgcggtagatgaaggcatcgcaatgggtggctgtgaatcaattaaaaat
gtagtggttttgaaaaaaactggtcaagagattacctggaatcaaaatgggaatgctaac
aacatctggtggcacgacttaattgctgggcaagcagacacatgtgaaccagtcatgttg
agcgcagaacatcctctattcttactttacacatcaggcagcacaggcaaacctaaaggc
gtgcagcattcatctgccggttatctattacacgccatgaacagcatgcgctggacattc
gacgtaaaagacaatgacgtgttttggtgtactgctgacgtaggttggattacaggtcat
acctatgtggcatatggtccactcgccatgggcgtgactcaagttgtgtttgaaggtatt
cctacttatccagatgcgggtcgcttctggcaaatgatacaaaaacataaagtgtcgatt
ttttacactgccccaacagcaattcgctcactgattaaggcatctgaaacaactgccagc
acgcatccgaagagctatgatttaagcagcttgcgcctgcttggttcggtaggcgagcct
atcaacccagaagcatggatgtggtattacgaaaacgtgggtggaggccactgcccaatt
gttgacaccttctggcaaactgaaactggcggtcacgtgattacaccgttacctggcgcg
acctcactcgttccaggctcttgcacactaccattcccaggtatagacattgatgtggta
gatgaaacaggtaaagacgtgccttggggtacgggtggcttattagtcattaaaaaacct
tggccttcaatgatacgaaccatttacaacgaccctgagcgctacaaatctagctattac
ccagtggacttgggcggcaaaatttacctagctggtgatggtgcagttcgcgatgcgaaa
acaggtaacttcaccatcatgggtcgtatcgatgacgtattgaacgtatctggccaccgc
ttaggcacgatggaaattgaatcagccttggtttcaaacccattggttgctgaagccgcc
gtagttggcaaaccacatgacattaaaggcgagtcagttgtggcctatgttgtgttaaaa
ggtcaacgtcctgaaggcgaagaactgaaaaaaatcgtcgcgcaactacgtgattgggta
ggtaaagaaattggcccgattgctaaaccagatgaaattcgttttggtgacaatttaccg
aaaactcgctcaggcaaaattatgcgtaggttgttacgcagcttagcgaaaggcgaagaa
attacttcagatatttctacactagataacccggcgattttggatcaactgaaagaagtg
gtgaaataa

DBGET integrated database retrieval system