KEGG   Methylotenera versatilis: M301_1784Help
Entry
M301_1784         CDS       T01247                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
meh  Methylotenera versatilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2010934..2011851)
Genome map
AA seq 305 aa AA seqDB search
MTNQLHGRDEKPISSNPSIDELLGSVGFIERKGNVGVLLIHGLTGTPTEMKQFGKLIARK
GFTVACPELAGHCATIEALSATKWHDWYISIEKAFDALKQECDHVFVAGLSMGALIALLL
AAKRGNQVAGVILLSTTFFYDGWNVPKFKQTFLLPLVLYTPLKYFFHWEETSPYGIKDER
TRALVHAILENRDNQAADKIGYFKTPATVILESVRMIDAAKKVLKNVIVPTLIVHATEDD
MASIRNAHYTQANISSKTVETFFVDDTYHVLTLDKRKDDVAKRAAQFCKEQAHILTSNNK
VSLAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcaattgcatggccgcgatgaaaagccaatatctagtaatccatctattgat
gaattactaggttcggtcggctttattgagcgtaaaggtaatgttggtgtgttgttgatc
catggattaactggtacacctactgaaatgaagcaatttggcaaattgattgcacgtaaa
ggttttactgtagcatgtcccgagttggctggtcattgtgccactatagaagcactatca
gcgactaaatggcatgattggtatatatccatcgaaaaagcatttgatgcacttaaacag
gagtgtgatcatgtgtttgttgcaggcctttctatgggggccttaattgcactcctgctt
gcagcaaaaaggggtaatcaagtagctggcgtgatattgttatctaccaccttcttttac
gacggttggaatgtgccaaaattcaaacaaactttcttgttgccacttgtactttacacg
ccgcttaaatactttttccattgggaagaaacctcgccctatggaattaaagatgagcgc
acacgtgcactggttcatgcaattttagaaaatcgtgataatcaggcagcagataaaatc
ggctatttcaaaacaccagcaacggtgattcttgagagtgtacgcatgattgatgcagct
aaaaaagtactgaaaaatgtgattgtcccaactttaatcgtgcatgcaactgaagatgat
atggcaagtatcaggaatgcacattatactcaagcaaacatttcatctaaaacagtggaa
acattctttgtagatgacacctatcatgtgctgacactggataaacgtaaagatgatgtt
gctaagcgtgctgctcaattttgtaaagaacaagcacatatattaacttcaaataataaa
gtctcattagcagcttaa

DBGET integrated database retrieval system