KEGG   Methylotenera versatilis: M301_1803Help
Entry
M301_1803         CDS       T01247                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
meh  Methylotenera versatilis
Pathway
meh00010  Glycolysis / Gluconeogenesis
meh00051  Fructose and mannose metabolism
meh00562  Inositol phosphate metabolism
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01120  Microbial metabolism in diverse environments
meh01130  Biosynthesis of antibiotics
meh01200  Carbon metabolism
meh01230  Biosynthesis of amino acids
Module
meh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_1803
   00051 Fructose and mannose metabolism
    M301_1803
   00562 Inositol phosphate metabolism
    M301_1803
Enzymes [BR:meh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M301_1803
Exosome [BR:meh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M301_1803
  Exosomal proteins of bladder cancer cells
   M301_1803
  Exosomal proteins of melanoma cells
   M301_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI30180
UniProt: D7DJE5
Position
complement(2033828..2034580)
Genome map
AA seq 250 aa AA seqDB search
MGKKLVVANWKMHGNLAENKLLFQAYIDQLSSLKNTDVVVCVPYPYLAQAQSMLQNTNIA
WGAQNLSKDAVGAHTGEVSAAMIKDFGASYVIIGHSERATAYCESDENIATKFVQAQAHG
LIPILCVGETLIEREAGVMQMVVGKQLDTIINTYGAAVFANSVVSYEPIWAIGTGLAASS
DQAQSMHEFIRGKVAVLDKTAATSMKILYGGSVNPQNAVQLFAMQDIDGGLIGKCSLNAQ
EFERICCAAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaattagtcgttgccaattggaaaatgcatggcaatctggcagaaaataag
ctgttatttcaagcttatattgatcagctatcctccctaaaaaataccgatgttgtcgtt
tgtgtgccatatccttatttagctcaagcgcaatccatgctgcaaaataccaatatcgct
tggggtgcgcaaaacctaagtaaagatgcagtaggtgcgcacacaggtgaagtgagtgcc
gcaatgattaaagactttggtgcaagttatgtgattattggtcattcggaacgtgcaaca
gcctattgtgaatcagatgaaaatatcgccactaaattcgtgcaagcgcaagcacatggt
ttaattcctattctgtgtgtaggtgaaaccttgattgagcgcgaagcaggcgtcatgcaa
atggtggtaggcaaacaattagataccattatcaatacatatggcgcagccgtatttgct
aattcggtggtttcatatgaaccaatttgggcgattggcacaggtttagccgcaagctct
gaccaagcgcaaagcatgcacgaatttattcgcggtaaggttgctgtgctggataaaacg
gccgcaacaagcatgaaaatcctctatgggggcagcgtaaacccgcaaaatgcggtacaa
ttattcgctatgcaagatatagacggtggtcttatcggtaagtgctcattaaatgcacaa
gaatttgaacgaatatgttgcgctgcggcctga

DBGET integrated database retrieval system