KEGG   Methylotenera versatilis: M301_2109Help
Entry
M301_2109         CDS       T01247                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
meh  Methylotenera versatilis
Pathway
meh00900  Terpenoid backbone biosynthesis
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M301_2109
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M301_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADI30478
UniProt: D7DKN2
Position
2345979..2346851
Genome map
AA seq 290 aa AA seqDB search
MQDFQSFLAPAKINLFLHITGQRADGYHLLQTVFCLLDLYDTVKLKPSTDGVVKRVNDVA
GVPAEQDLCVRAAKLLQQHTKCPLGVDILVEKHIPIGGGLGGGSSDAATVLIALNSLWQL
SLSRKELMSLGLKLGADVPFFIFGNNAWAEGIGEQLTEINLHNSYYVVLNPNIHVSTAQI
FANKQLTKNTNPKTMSDFSGTAKLTACNLNAEFINDLEKIVCSEYPAVLDCLNWLSQFGD
ARMSGSGASVFLEVVDEKTAVDICNQKPKSVQGFVAKGLNQHPLINLTVN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattttcaatcatttttagcgccggcaaaaatcaatttatttctgcacatcaca
ggtcagcgcgcagatggctaccatttactgcaaaccgttttttgtctacttgatttatac
gacacagtaaaactcaaaccctccacagacggcgttgtaaagcgcgtgaatgatgtggct
ggcgtgcctgcagagcaagatttatgtgttcgtgcggctaaattgttacagcaacataca
aaatgcccacttggcgtagacattttggttgaaaagcacatccctataggcggcggtctt
ggtggcggcagttcagatgcagcaaccgtgctaatagctttaaatagcttgtggcagctt
agcttaagccgcaaagagcttatgtcactgggattgaaattgggcgccgatgtacctttc
tttatttttgggaacaacgcctgggcagaaggcataggcgagcaattaacagagattaat
ctgcacaattcctactatgttgtgctgaatccgaatatacatgtatcaacagcgcaaata
tttgccaataagcaattgacaaaaaacacgaatcctaagacaatgtcggacttttctggg
acggctaaattaacagcatgtaatttaaatgctgaatttataaatgacctagaaaaaata
gtctgcagtgaatatcccgcagttttagattgtttgaattggcttagtcaatttggcgat
gcaagaatgagtggttctggtgcttcggtctttttagaagtagtagatgagaaaactgca
gtagatatatgcaatcaaaaacctaaaagtgttcagggatttgttgcaaaagggttgaat
cagcacccgctaataaatcttacggttaattag

DBGET integrated database retrieval system