KEGG   Methylotenera versatilis: M301_2156Help
Entry
M301_2156         CDS       T01247                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
meh  Methylotenera versatilis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M301_2156
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     M301_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2389975..2390466
Genome map
AA seq 163 aa AA seqDB search
MKQAFVALGSNLANPISQVESAFAALENLPNTRVIKKSSLYKTAPIGYEAEQLNQIPDFI
NAVAELETDLAPLELLDALLEIENQAGRERPFPNAPRVLDCDLLLYENVSMESTKLILPH
PRMHQRGFVLLPLFEIAAQLSIPNHGKIATLIHEQQFTGITKL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcttttgttgcgctagggagtaatttagcaaacccaatttcacaagtagaa
tctgcctttgcagcacttgaaaacctaccaaacacacgtgtgataaagaagtcatcttta
tataaaacggcaccgataggctacgaagctgagcaactaaaccagattccagactttatt
aatgcagtagcggagcttgaaacagatttagccccgcttgaattgctcgatgcgctattg
gaaattgaaaatcaggctgggcgtgaacgccctttccccaatgctcccagggtgttagat
tgtgatttactgctttatgagaatgtaagcatggagtccaccaagctcatattgccacat
ccaagaatgcatcaacgcggtttcgttttattaccattatttgaaatcgcagcacaatta
tccatcccgaatcatggcaaaatagcgacattgattcacgagcagcaatttactggcatt
acaaaactatag

DBGET integrated database retrieval system