KEGG   Methylotenera versatilis: M301_2165Help
Entry
M301_2165         CDS       T01247                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M301_2165
   01230 Biosynthesis of amino acids
    M301_2165
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_2165
   00051 Fructose and mannose metabolism
    M301_2165
   00562 Inositol phosphate metabolism
    M301_2165
Enzymes [BR:meh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M301_2165
Exosome [BR:meh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M301_2165
  Exosomal proteins of bladder cancer cells
   M301_2165
  Exosomal proteins of melanoma cells
   M301_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2396919..2397686
Genome map
AA seq 255 aa AA seqDB search
MRRNLVVGNWKMHGDIHSNETLLNTLITGLSDYKSADYVVCVPNPYLHQTRSLLENTGIA
WGGQNVNQFEEGAFTGAVSPHMLTDLGCTYVLLGHSERRVLFHETNLSAAARFDASIKAN
LTPILCVGETLAEHDAGLTEVIVASQMDAVMATLNDENFAKAMELNMVFAYEPVWAVGTG
KTATPEQAQEVHQFIRQRIARRNAEAASKVRIIYGGSVKAQNAAKLFSMPDVDGGLVGGA
SLNAEEFIAICKAAN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtaacctagtagtaggcaattggaagatgcatggtgatatccatagcaatgaa
actctactcaacacactgattactggattaagtgattacaaaagtgcggattatgtcgtt
tgtgttccaaacccatacttacaccaaacaaggtcattactagaaaacactggtattgca
tggggtggacaaaacgttaaccagttcgaagaaggtgcattcactggcgccgtctctccg
cacatgctcacagacctaggctgcacctatgtgctgcttggacactcggaaagacgcgtg
ttatttcatgaaaccaatctatccgccgccgctagatttgatgcatcgattaaagccaat
ctaacgccaattttatgtgtaggtgaaacccttgctgaacatgatgcgggactgacagaa
gttatcgttgcaagccagatggatgccgtaatggcaacccttaatgatgaaaattttgct
aaagcgatggaactgaatatggtgtttgcatatgagccagtatgggctgttggcacaggc
aaaaccgccacgccagagcaagcacaagaagtgcatcaatttatacggcaacgcatcgct
agacgtaatgctgaagcagcctcaaaagtccgtattatttatggcggcagtgtgaaagct
caaaatgccgctaaattattcagtatgccagatgttgatggcggcttggttggtggcgca
tcactcaatgcggaagagttcatcgccatttgcaaagcggctaactag

DBGET integrated database retrieval system