KEGG   Methylotenera versatilis: M301_2246Help
Entry
M301_2246         CDS       T01247                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
meh  Methylotenera versatilis
Pathway
meh00040  Pentose and glucuronate interconversions
meh00052  Galactose metabolism
meh00500  Starch and sucrose metabolism
meh00520  Amino sugar and nucleotide sugar metabolism
meh01100  Metabolic pathways
meh01130  Biosynthesis of antibiotics
Module
meh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M301_2246
   00052 Galactose metabolism
    M301_2246
   00500 Starch and sucrose metabolism
    M301_2246
   00520 Amino sugar and nucleotide sugar metabolism
    M301_2246
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M301_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DDE_Tnp_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADI30611
UniProt: D7DLE0
Position
complement(2481393..2482280)
Genome map
AA seq 295 aa AA seqDB search
MKKVTKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVAAGITDLIFITGRN
KRSISDHFDMAYELENELERNGKTELLKIVQNIVPKNVNCIYIRQTQALGLGHAVRLAKP
VVNDDAFAVILADDLLDGKTPIMKQMVEAYDYYRCSLLGVENVPADQTKSYGIVATTPLN
KNIEQVSAIVEKPDPKDAPSTLAVVGRYILTPRIFHHLDNVKAGAGGEIQLTDGISGLLT
EEQILAYRFDGVRYDCGSKFGYLEATIRLGLKHPEVSKDLRALLESIVNDKKKAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttactaaagcagttttcccagttgccggtttaggcacacgttttttgcca
gctaccaaagcaaatccaaaagaaatgctacccattgtagataagccattgattcaatat
gcagttgaagaggcagttgcggcaggaattactgatttaatttttattacaggtagaaat
aagcgttctatatctgaccattttgatatggcgtacgagttagagaatgagcttgagcgt
aacggtaaaaccgaattacttaaaatagtacaaaatattgttcctaaaaacgttaactgt
atttatattcgccaaacgcaagctttgggtttaggccatgcggtgcgcttagctaagcct
gtggtgaatgatgatgcatttgctgtgattttagcggatgatttacttgatggtaaaacg
cctatcatgaagcaaatggtagaggcttatgattactaccgttgctcacttctaggcgtt
gagaatgtaccagcagatcaaaccaagagctatggtattgttgcaaccacgccactcaac
aaaaatattgagcaagtttcagcgatcgtagagaagcctgatccaaaagatgcaccatct
acattggcggtggtaggacgttatattctgactcctagaattttccatcacttagacaat
gtgaaagctggtgccggcggtgaaatacaattaaccgatggtatttcaggattgcttact
gaagaacaaatattagcgtaccgatttgatggtgtacgctatgactgtggctctaaattt
ggttatttagaagcaacgattcgtctaggactaaaacatccagaagtttctaaagactta
cgtgctttgttagagtctattgtgaatgataaaaagaaagctagctaa

DBGET integrated database retrieval system