KEGG   Methylotenera versatilis: M301_2575Help
Entry
M301_2575         CDS       T01247                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
meh  Methylotenera versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M301_2575
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     M301_2575
Exosome [BR:meh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M301_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2819016..2820005)
Genome map
AA seq 329 aa AA seqDB search
MSYPYARPRRMRKDEFSRRMMRENVLTTDDLIYPVFVLDGENRTEEVASMPGVKRQSIDV
LLKTAAECVALGIPLIALFPVVDSKFKSLDAAEAYNPEGLAQRAVMALKAAFPQLGVMTD
VALDPFTTHGQDGLIDDTGYVMNDETIEVLVKQAISHANAGADIVAPSDMMDGRIGQIRE
ALESTRNIHTKILAYSAKYASAFYGPFRDAVGSAGNLGSGNKYTYQMDPANSDEAMQEVA
LDISEGADMVMVKPGMPYLDIVRRVKDEFGVPTFAYQVSGEYAMLKAAAQNGWLDEKACV
MESLLAFKRAGADGILTYFAMDAARWLKG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagctatccctacgcccgcccacgccgtatgcgtaaagacgaattttcacgccgcatg
atgcgcgaaaacgtactgacaaccgatgatttaatctacccagtattcgtattagatggt
gaaaatcgtacagaagaagtagcttctatgccgggtgtaaagcgtcaaagcattgatgtg
ctgctaaaaacagccgctgaatgcgtagcgcttggtattcctcttattgcattgttcccg
gtggtcgatagcaaatttaaaagcctagatgccgctgaagcctataatccagaaggttta
gcgcaacgcgctgtgatggcattaaaagcagcctttccacaactcggtgtgatgactgat
gtagcattagacccattcaccacccacggtcaagatggcttgattgatgatacgggctac
gtgatgaatgatgaaaccatagaagtattggttaaacaagctatctctcacgccaatgca
ggtgctgatattgttgcgcctagtgacatgatggatggtcgtattggtcaaattcgtgag
gcgttagaaagtacacgtaatattcacaccaagattttggcttattcagctaaatacgct
tcagcattctatggtccattccgcgatgcagtgggttcggctggcaatttaggttcaggc
aataaatatacttatcaaatggatcctgccaatagcgacgaggcgatgcaagaagtcgcg
ctggatatttcagagggtgcagatatggtgatggtgaaaccaggtatgccgtatttggat
attgtgcgccgcgtgaaagatgagtttggcgtgcctacgtttgcgtatcaggtgagtggt
gaatatgcgatgttgaaagcagcagcgcaaaacggctggctggatgagaaggcttgcgtg
atggagagtttgttggcgtttaaacgggctggggcggatgggattttgacttattttgcg
atggatgcggcgcggtggttgaaaggctga

DBGET integrated database retrieval system