KEGG   Methylotenera versatilis: M301_2729Help
Entry
M301_2729         CDS       T01247                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
meh  Methylotenera versatilis
Brite
Enzymes [BR:meh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     M301_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 MTS Methyltransf_12 Methyltransf_18 NodS Methyltransf_23 Ubie_methyltran Methyltransf_PK PrmA MetW TehB Methyltransf_32 Methyltransf_4 DREV
Motif
Other DBs
NCBI-ProteinID: ADI31083
UniProt: D7DP52
Position
complement(2984330..2985013)
Genome map
AA seq 227 aa AA seqDB search
MTQTQQTTKNQSTDLARFNMIEQQIRTWEVLDPVVLDLLGEVHREDFIDESQLGLAFADV
ELPIGHGQTMLSPKIEGRILQALNIKRTDKVLLVGTGSGYLTALIAKLAKHVDALEIIPE
LSKQAEARIQKQNIHNVTFYVLDAFSGYTTDKTYDVIVFAGSLQLHPSAAEQMLNIGGRM
FAVVGEMPIMQATLTQRVSEGSSRKETLFETCLPPLVNAPQSIKFEF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacacaacaaaccactaaaaatcagtcaacagacttagcgcgcttcaacatg
atagagcagcaaattcgcacatgggaagtgttagatcccgtcgtactggacttgctcggc
gaagtgcaccgtgaagacttcattgatgaatcacaactaggtctagcctttgccgatgtg
gagttgccgattggccatggtcagaccatgctttcaccaaaaatcgaaggccgtatctta
caagcgcttaacatcaaaagaaccgataaagtattgctggtcggtactggcagcggttat
ttaactgcgctgattgccaaacttgcaaaacatgtggatgccttggaaatcattccggag
ctctctaaacaagcggaagctcgcatacaaaagcaaaatatccacaatgtgactttctat
gtacttgatgctttcagtggttacaccacggataagacgtacgatgtcatcgtatttgcc
ggctctttgcaattacacccaagcgccgctgaacaaatgttgaatattggtggtcgtatg
tttgctgtggttggtgaaatgccaattatgcaagccacgcttacgcagcgtgtgagtgaa
ggtagtagccgtaaagaaacactttttgaaacctgcttgccgccactagtgaatgcccca
caatctattaaatttgagttttaa

DBGET integrated database retrieval system