KEGG   Methylovorus glucosetrophus: Msip34_0033Help
Entry
Msip34_0033       CDS       T00943                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mei  Methylovorus glucosetrophus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msip34_0033
Enzymes [BR:mei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Msip34_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(37277..38080)
Genome map
AA seq 267 aa AA seqDB search
MADLPLSSVALTGLSVAITRPLDQATRLSRLIVEAGGTPYGFPLIEIAPLADYSAFDAQL
HELGKYDWTIFISSNAVQNAIPRMLNLVGQPPATLRHAAIGPVTAAELTSLGIGPVLTPQ
GRYDSESLLALPEMQQVKGQRFLIFRGVGGRELLAESLRARGATVDFAECYRRINPQTSA
EPLEQRWQQQQLDAVVVTSSEAMRHLLNMTNNGQHAWIRDVTLCVNHARIAELPIELGLH
VIVAEAPGDDAMLQCLNTVALLKQQRH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttaccactgagcagcgtggcattgacaggcttgtcggtggcgatcacccgg
ccgttggatcaggccacgcgcttgtcgcgcttgatcgtggaagcaggcggaacgccctat
ggctttccgctgattgaaattgccccgctggcagattacagcgcatttgatgcccagctg
catgagctcggcaagtacgattggactatttttatcagcagtaatgcggttcagaatgcc
ataccaaggatgctgaatctggtcggccagccgccagccacattgcggcatgctgccatt
ggtccggtcaccgctgccgaactgaccagcctgggcatcgggccagtgctaacgccacaa
ggcaggtatgatagtgaatcgctactggcactccccgagatgcagcaggtaaaggggcaa
cgatttttgatttttcgtggagtgggtggccgggaactgcttgcagagagcctgcgagcc
cgcggtgctactgtggattttgccgagtgctaccgccgcatcaacccgcaaaccagcgca
gagccactggaacagcgttggcaacaacagcagcttgatgccgttgtagtcaccagcagt
gaagccatgcgccatttgctgaacatgacgaataacggacagcacgcctggatacgcgat
gtgacactgtgtgtgaatcatgcacgcattgccgaactgcccattgagcttggattgcac
gtcatcgtggcagaagcgccgggagacgatgccatgctgcaatgcctgaatactgtagcc
ctcttgaaacaacaacgacactga

DBGET integrated database retrieval system