KEGG   Methylovorus glucosetrophus SIP3-4: Msip34_0051Help
Entry
Msip34_0051       CDS       T00943                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mei  Methylovorus glucosetrophus SIP3-4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mei00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
58271..58879
Genome map
AA seq 202 aa AA seqDB search
MTGNLFIITAASGAGKTSLVRELLASDSQIQLSVSYTTRKPRPGEVDGVHYHFVEEAEFM
RMLEASDFLESAHVHGARYGTSQSRVESVLKQGNDLILEIDWQGAAQVRSLYPQAISIFI
LPPSLEALEQRLHGRGQDSAEVIARRLAAARDEMRHVVEFDYVTINDDFEVALNDLRAII
RTQRLQREKQLLRHQDLLEKLI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaatctatttatcatcaccgcggcatctggcgcgggtaaaaccagtctggtg
cgcgagttgctggcgtcagacagccagatccagctgtcggtgtcgtacaccacccgcaag
ccgcgaccaggcgaggtggatggggtgcactatcactttgtggaagaggctgaattcatg
cgcatgctggaagccagcgactttctggaaagtgcgcatgtgcatggtgcgcgctatgga
acatcgcaaagccgggtggaaagcgtgttgaagcaaggcaatgacctgattctggagatt
gactggcagggcgctgcccaggtgcgcagtctttacccgcaggccatcagcatttttatt
ctgccaccctcgctggaggcactggagcagcgcctgcacggccgtggtcaggatagcgcc
gaggtgattgcccggaggctggcggctgctcgcgatgagatgcgccatgtggtcgagttc
gactatgttacaattaacgacgattttgaggtggcgctaaatgatctgcgcgccatcatc
cgcacccagcgtttgcagcgcgaaaagcagttgctgcggcaccaggatctgctggaaaaa
ctcatatag

DBGET integrated database retrieval system