KEGG   Methylovorus glucosetrophus: Msip34_0266Help
Entry
Msip34_0266       CDS       T00943                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00340  Histidine metabolism
mei01100  Metabolic pathways
mei01110  Biosynthesis of secondary metabolites
mei01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Msip34_0266
Enzymes [BR:mei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Msip34_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACT49515
JGI: Msip34_0266
UniProt: C6X8P5
Position
288651..289949
Genome map
AA seq 432 aa AA seqDB search
MNIRRFSTRDATFDADLKALLAFETAQDDQIDLVVADILRNVKQRGDAAVLEYTKRFDHL
DVAGLSSLEISQVELHAALEALPAAQREALQQAAERVRLYHEKQLMSSWSYTEDDGTLLG
QQVTPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVEELIMVVPTPNGERNQLVLAAAAV
CGVDRVFCIGGAQAVGALAYGTETVPQVDKIVGPGNAYVAAAKRRVFGVVGIDMVAGPSE
ILVICDGKTNPDWVAMDLFSQAEHDELAQAILLSPDAEFLDKVAASAARLVEEMPRKDII
KTSLQGRGALIQVKDLEEAARISNYIAPEHLELSLDDPLAFSKKIKHAGAIFMGRDTCEA
LGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIMVSAEGAQKLGKVAATLAYGEGLQ
AHARSAEYRLKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgacgcttttctactcgtgatgccacctttgatgcggatctcaaagccttg
ctggcatttgagaccgctcaggatgaccagattgatctggtggttgccgatatcttgcgc
aatgtaaaacaacgtggtgatgccgctgtgctggaatacaccaagcgctttgatcatctg
gatgtggcaggtctttcctctctggaaatctcccaagtagaactgcatgccgcactggaa
gcactgccggctgcccagcgcgaggcgttgcaacaagcggccgagcgcgtgcgtctttac
cacgagaagcagttgatgtcgtcctggagttataccgaggatgatggcactttgctgggc
caacaagtgactccgcttgatcgcgtgggcttgtatgtacctggcggcaaggcagcctac
ccctcatcggtgctgatgaatgctattccagccaaggtggcaggcgtggaagaactgatc
atggtagtgccgacacccaatggtgagcgtaaccagctggtattggcggctgcggcggta
tgtggcgtagatcgcgtgttctgcatcggcggtgctcaggccgtgggagctctggcatat
ggcaccgagaccgtaccgcaggtagacaagattgtcgggcctggcaatgcctatgtggcc
gctgccaagcgccgcgtatttggcgtagttggtattgatatggtggccggaccttctgaa
attctcgtgatctgtgatggcaagaccaatccggactgggtggcgatggatttgttttcg
caagccgagcacgacgagcttgcccaggccattttgttatcgcccgatgccgagtttctc
gacaaggtcgccgccagtgcagcacgtctggttgaagagatgccgcgcaaggacatcatc
aagacatcgctgcaaggccgtggcgcgctgattcaggtgaaggatctggaagaagccgct
cgcatcagcaattacatcgcccctgaacatctggagctttcactggatgatcctctggcc
ttcagcaagaagatcaaacacgccggtgccatcttcatggggcgtgatacctgcgaagca
ctgggggattactgtgctgggcctaatcacgtgttgcctacttcacgcacggccagattt
tcttcgccgcttggtgtgtacgatttccagaagcgctccagcctgatcatggtatcggcc
gaaggtgcgcaaaaactgggcaaagtggccgctaccctcgcgtatggcgaaggcctgcaa
gcacacgcccgttctgcggagtaccggcttaaaaaatga

DBGET integrated database retrieval system