KEGG   Methylovorus glucosetrophus: Msip34_0299Help
Entry
Msip34_0299       CDS       T00943                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
mei  Methylovorus glucosetrophus
Brite
Translation factors [BR:mei03012]
 Eukaryotic Type
  Elongation factors
   Msip34_0299
 Prokaryotic Type
   Msip34_0299
Mitochondrial biogenesis [BR:mei03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Msip34_0299
Exosome [BR:mei04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Msip34_0299
  Exosomal proteins of breast cancer cells
   Msip34_0299
  Exosomal proteins of colorectal cancer cells
   Msip34_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
320052..321242
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSKYDFPGDDIPVIKGSALKALE
GDQSEIGEPAIFRLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGIVK
VGDEIEIVGIKPTLKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKTGS
IKPHTKFSAEIYVLGKDEGGRHTPFFNGYRPQFYFRTTDVTGAVELPAGTEMVMPGDNVS
ITVALIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaatttgagcggacgaagccgcacgtcaacgtaggcacgattggtcac
gttgaccatggtaagacgacgctgacagcggcgatcacgacaattctgtcgaagaagttt
ggtggtgaagccaaggcatacgaccagatcgatgcggcgccagaagaaaaggcacgtggt
attaccatcaacacagcgcacgttgaatacgaaactgcaactcgccactacgctcacgta
gactgcccaggccacgccgactatgttaagaacatgattaccggtgctgcgcagatggac
ggcgcgattctggtctgttccgccgctgacggcccgatgccacaaacccgtgaacacatc
ctgctggcacgtcaggttggcgtaccttacatcgtcgtgttcatgaacaaggccgacatg
gtggatgacgccgagctgctcgagctggttgaaatggaaatccgcgaactgctctccaag
tacgacttcccaggcgatgacatccctgtgatcaagggttccgccctgaaggcgctggaa
ggcgaccaatccgaaatcggcgaacctgccatcttccgtttggcagatgcgctggacagc
tacatcccaaccccagagcgcgctgttgacggcaccttcctgatgccagtagaagacgta
ttctccatctctggtcgcggtactgtcgttactggccgtatcgagcgtggtattgtgaag
gttggcgacgaaatcgaaatcgtaggtatcaagccaaccctgaagaccacctgcaccggc
gtagaaatgttccgcaagctgctggaccaaggtcaagcaggcgacaacgttggcgtactg
ctgcgtggtaccaagcgtgaagaagttgagcgtggtcaagtattggccaagactggttcg
atcaagccacacaccaagttcagcgcagaaatctacgtgctgggcaaggacgaaggcggc
cgtcacaccccattcttcaatggctaccgtccacagttctacttccgtaccactgacgta
actggtgcagtagaactgccagcaggtaccgaaatggtaatgccaggcgacaacgtatcc
atcaccgtggcactgattgccccgatcgcgatggaagacggtctgcgctttgcgattcgt
gaaggcggccgtaccgttggtgccggcgtcgtcgcgaaaattattgagtaa

DBGET integrated database retrieval system