KEGG   Methylovorus glucosetrophus: Msip34_0585Help
Entry
Msip34_0585       CDS       T00943                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mei  Methylovorus glucosetrophus
Brite
Enzymes [BR:mei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Msip34_0585
Secretion system [BR:mei02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Msip34_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
610297..611019
Genome map
AA seq 240 aa AA seqDB search
MIKKLMGMMLVAAFSLNVHADEASLRKAIEATYPKVRVESITKTSYAGLYEVFLDGQIIY
TDDKFSFLIADGRLIEPKSKRDVTGERLDELTKVDFSSLPLDQAIKVVKGNGSRKLVVFS
DPDCPYCKRLEQKELVNINDVTIYTFLFPLEQLHPDAVNKSKAIWCATDRAKAWQDWVLN
GQLAKAGNCDTSAIDKSAELGRKLGVVSTPTLIFADGKRMLGAYPAKDIEKAMSTTPAKK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagttgatgggaatgatgctggttgcggcgttcagcctgaatgtgcacgcc
gatgaagccagcctgcgcaaggcgattgaagcgacgtatcccaaagtgcgcgttgaaagt
atcaccaaaaccagctatgcgggcttgtatgaggtatttctggatggtcagattatctat
accgacgacaaattcagctttctgattgcggatggccgtcttatcgagcccaagtccaag
cgtgatgtgactggcgagcgtctggatgaactgaccaaggtggacttttcttccttgccg
ctggatcaggccatcaaggtcgtcaagggcaatggcagccgcaagctggtcgtgttttct
gacccggactgcccttattgcaaacggcttgagcaaaaagagctggtgaatatcaacgat
gttacgatctacaccttccttttcccgctggaacaactgcatcctgatgcggtaaacaaa
tccaaggccatctggtgcgctactgatcgcgccaaggcctggcaggattgggtgctgaat
ggtcagctggccaaagccgggaactgcgatacttctgcgattgataaatcggccgagctt
ggtcgcaaactgggcgtggtgagcacccccaccctgattttcgccgatggcaaacgcatg
ctgggtgcgtatcctgccaaggatattgaaaaagccatgagcaccacgccagcaaagaaa
taa

DBGET integrated database retrieval system