KEGG   Methylovorus glucosetrophus: Msip34_0669Help
Entry
Msip34_0669       CDS       T00943                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mei  Methylovorus glucosetrophus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msip34_0669
   01230 Biosynthesis of amino acids
    Msip34_0669
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msip34_0669
   00051 Fructose and mannose metabolism
    Msip34_0669
   00562 Inositol phosphate metabolism
    Msip34_0669
Enzymes [BR:mei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msip34_0669
Exosome [BR:mei04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msip34_0669
  Exosomal proteins of bladder cancer cells
   Msip34_0669
  Exosomal proteins of melanoma cells
   Msip34_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
701398..702153
Genome map
AA seq 251 aa AA seqDB search
MRRKLVVANWKMHGDLAQNKVLFDAFRQRLDHLTSADIAVCVPYPYLFQAQQELQGSHIA
WGAQNVAKHEVGAYTGEVSARMLKDFGASYVIVGHSERSTAYCESDENIAAKFVVARKSG
ITPVLCLGETLAERESGLCHQVIASQIDAVLKTVGAGVFAHAVVSYEPVWAIGTGLSATP
GQAQQVHAFIRDRIAALDVHAAETVRILYGGSVNPLNASQLFVMPDIDGGLIGRCSLNAN
DFEEICRAACQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaagctggtggtcgctaattggaaaatgcatggcgaccttgcgcaaaacaag
gtgctgtttgatgcattcaggcagcgccttgatcatttgacttcggcagatattgcggtc
tgcgtgccatacccttatctgtttcaggcgcagcaggagctgcagggcagccatattgcc
tggggcgcccagaatgttgccaagcatgaagtcggagcatacaccggagaagtcagtgcg
cgcatgctcaaggactttggtgccagttatgtaattgtggggcattccgagcgcagtacc
gcctattgcgaaagcgacgagaatattgccgccaaatttgtggtggcgcgcaaatcgggc
atcacgcccgtgctttgcctgggagaaaccctggccgagcgcgagtccggtctgtgtcat
caagtgattgccagccagattgatgccgtgctgaagaccgtaggggctggagtgtttgcg
catgccgttgtttcctatgaaccggtatgggccatcggtacaggtttatctgcaacaccg
ggacaggcgcagcaggtacatgcgtttatccgtgatagaatcgccgcgctggatgtgcat
gcggcagaaaccgtaagaattctgtatgggggtagcgtaaatcccctaaatgcgtcacaa
ttattcgttatgccggatatagacggcggtttgattggcagatgttcattgaatgccaac
gattttgaggaaatttgtcgcgctgcttgtcagtag

DBGET integrated database retrieval system