KEGG   Methylovorus glucosetrophus: Msip34_0827Help
Entry
Msip34_0827       CDS       T00943                                 

Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mei  Methylovorus glucosetrophus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msip34_0827
   00030 Pentose phosphate pathway
    Msip34_0827
   00051 Fructose and mannose metabolism
    Msip34_0827
   00052 Galactose metabolism
    Msip34_0827
   00500 Starch and sucrose metabolism
    Msip34_0827
   00520 Amino sugar and nucleotide sugar metabolism
    Msip34_0827
  Nucleotide metabolism
   00230 Purine metabolism
    Msip34_0827
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msip34_0827
Enzymes [BR:mei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msip34_0827
    5.4.2.8  phosphomannomutase
     Msip34_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(864410..865783)
Genome map
AA seq 457 aa AA seqDB search
MLAPKEIFKAYDIRGIVGKTLTPEIVEQIGKAIGSEAAKLQQKAICIGYDGRLSGPELAE
ALARGILSTGVDVIRLGQVATPMVYFAAHQLKTGCGVMVTGSHNPPDYNGLKMVIAEETL
SGESIQRLRTRIEQQDFASGSGKASDYDIADDYINRIASDIKLSRPMRIAVDCGNGVPGA
YAGKLYRALGCEVEELFCEVDGHFPNHHPDPSVPENLLDLIAALGKGSSEIGLAFDGDGD
RLGVVTKDGKIIYPDRQLLLFAEDVLQREPGATIIYDVKSSRNLAPWIKARGGLPLMWKT
GHSLVKAKMKETGSALAGEMSGHVFFKERWFGFDDGLYSGARLLEILSRSSDPSALLNAL
PDSVSTPEQHIHMNEGEPHALIASLQKTAEFAGATEVITIDGLRVEYPDGFGLMRPSNTT
PVIVLRFEADDEAALRRIQEAFRSVILAAAPHVHLPF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaccaaaagagattttcaaggcttacgatatccgcggtattgtcggtaaaaca
ttgactcccgagattgtcgagcaaatcggcaaggcaataggcagcgaggctgccaaactg
cagcagaaagccatttgcataggctacgatggccgtctctccggccctgagctggcggaa
gccctggcacgcggcattctcagcacgggagtggatgtcatacgcctgggccaggtcgcg
acccccatggtgtattttgccgcgcatcagctcaagaccggctgtggcgtcatggtcacg
ggcagccacaatccgcctgactacaacggcctaaagatggtgatcgccgaggaaaccctt
tctggcgagagcatccagcgtttgcgtacccgcattgagcaacaggactttgccagcggc
agtggcaaggccagcgattacgacattgccgatgactacatcaaccgcattgcctctgac
atcaagctgagccgccccatgcgcattgccgtcgattgcggcaatggtgtgcctggcgcc
tacgcgggcaagctctaccgcgccctgggttgcgaagtggaagagctgttctgcgaggtc
gatggccacttccccaaccatcaccctgatccttccgtaccggaaaacctgctggatctg
attgccgcgctgggcaaaggcagctccgaaatcggtctggcattcgatggcgatggggac
cgccttggcgtggtcaccaaggatggcaagatcatctaccccgatcgtcagctgctgctg
tttgcagaagatgtcctgcagcgcgaacccggcgccaccatcatttatgacgtgaaatcc
tcacgcaacctcgcgccctggatcaaggcacgcggtggtttgccactgatgtggaaaacc
ggccactcgctggtgaaggcaaaaatgaaagaaaccggctccgccctggcgggcgaaatg
agcggccatgtattcttcaaggaacgctggttcggttttgatgatggcctctacagcggc
gcgcgcctgctggaaatcctcagccgctcgtccgacccatccgcgctgctgaatgcattg
ccagacagcgtcagcacacctgagcaacacatacacatgaatgaaggcgagccgcatgcg
ctgatcgccagcctgcaaaagaccgctgaattcgcgggcgccaccgaagtcatcaccatt
gatggtctgcgcgtggaatacccggacggctttggtctgatgcgcccatccaacaccacc
ccggtaatcgtgttgcgctttgaagccgatgatgaagccgcactgcggcgtattcaggaa
gccttccgcagtgtgattctggcggcagcgccgcacgtgcatctgcctttttaa

DBGET integrated database retrieval system