KEGG   Methylovorus glucosetrophus SIP3-4: Msip34_0970Help
Entry
Msip34_0970       CDS       T00943                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mei  Methylovorus glucosetrophus SIP3-4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mei00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mei00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1023488..1024543
Genome map
AA seq 351 aa AA seqDB search
MTLGPIMLDVVGTELDAADIRRLQHPLVGGVILFARNYQSPTQLKALTASIHAVRQPPLL
IGVDHEGGRVQRFREGFTRIPPMREFGKIWDKQPKKAKQLAEEAGWLMAVELRAHGIDFS
FTPVLDMDYGVSQVIGDRAFHMQPQAIAELAYALMQGLKRGGMAAVGKHFPGHGYIAADS
HVAIPVDERSFDEIASTDMQPFRQMIDDGLPAIMPAHVIYPKVDDKPAGFSERWLQKVLR
QRLAFNGVIFSDDLSMEGAVVAGNVTQRALAALNAGCDMALLCNRPDLADELLENLQWNI
SAPSLARLARMHGKLHPADMTALRESHEYIEAVHTISQIGIHEDDMFAEAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacattaggcccgattatgctggatgtggttggcaccgaactggacgccgccgatatc
cgccgtttgcaacacccgctggtgggcggggtgatcctgttcgcccgcaactaccagtcg
cccacacaactgaaagccctcaccgccagcattcatgccgtgcgccagccacccttgctg
ataggcgtggaccatgagggtggccgcgtgcagcgtttccgcgaaggctttacccgcatt
ccgcccatgcgcgaattcggcaagatctgggataaacaaccgaaaaaagccaaacagctg
gccgaagaagcaggctggctgatggccgtggaactgcgtgcccatggcattgatttcagc
tttacgccagtgctggatatggattacggcgtcagccaggtaatcggcgatcgcgccttt
cacatgcagccacaagccattgccgagctcgcgtatgcgctgatgcaaggcctcaaacgt
ggtggcatggcggcagttggcaagcatttccctggccatggctacattgctgccgattcc
catgtggcgattccggtggatgaacgcagctttgacgagattgcctctaccgacatgcag
ccttttcgccagatgattgatgacggcctgcccgccatcatgcctgcgcatgtgatctac
cccaaggtggacgacaagcccgctggcttttcggagcgctggctgcagaaagtcctgcgg
caacgtctggcgttcaatggcgtgattttcagcgatgatctgtcgatggaaggcgcggtg
gtggcgggcaatgttacccagcgtgcgctggccgcactgaatgccgggtgtgatatggcc
ttgctgtgcaaccgtcccgaccttgccgatgagctgcttgaaaatcttcagtggaatatt
tcggcacccagtctggcacggctcgcccgcatgcatggcaaactgcatccggctgacatg
acggccctgcgcgaaagccacgagtatatcgaggcggtgcataccatcagccagatcggc
atccatgaggatgacatgttcgccgaggcttcctga

DBGET integrated database retrieval system