KEGG   Methylovorus glucosetrophus SIP3-4: Msip34_1202Help
Entry
Msip34_1202       CDS       T00943                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mei  Methylovorus glucosetrophus SIP3-4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1284704..1285537)
Genome map
AA seq 277 aa AA seqDB search
MSLEQLIGENGFIEGKGQDAVLLVHGLTGTPAEMKHYGKVLARKGLTAVCPVLAGHCASI
KTLTATTWQDWVSSIEQVFLEMRKRYRKVFIAGLSMGALIALMVAARYKEAVAGVILLSV
TLFYDGWNMPPFKQRFLLPIVLYTPLKYFVHWEETAPYGIKCERTRALVAAILDNKDAQA
SEKIGYFKTPATVILESVRLIRQAKKQLADVVSPVLIVHSTEDDMASIKNAHYVEKRLGS
RDIQTMYISDTYHVLTLDKRKDDIAKRSAEFCLALAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggaacagctgattggtgaaaacggctttatcgaaggcaaagggcaagatgcc
gtgctgctggtgcacggcctcaccggcaccccggccgagatgaagcattatggcaaagtg
ctcgcccgcaagggcctcactgccgtttgcccggtgctggccgggcactgcgcttcgatc
aaaaccctgaccgccaccacctggcaggattgggtgagttcgatcgagcaggtgtttctg
gaaatgcgcaaacgttatcgcaaggtgtttatcgccgggctttccatgggggcgctgatc
gccctcatggtggcagcgcgttataaagaagcggtggctggcgtcattctgctatcggtc
acgctgttttatgacggctggaacatgccgccattcaagcaacgcttcctgctgcctatc
gtgttgtataccccgctcaaatacttcgtgcactgggaagaaactgcgccctacggcatc
aagtgtgaacgcacccgggcgctggtcgcggcgattctggataacaaggatgcccaggct
tccgagaagatcggttatttcaaaacgcccgccacggtgattctggaaagcgtgcgcctg
atccgccaggccaagaaacagctggcagatgtggtatcgccagtgctgatcgtgcattcc
acggaagacgacatggcgagcatcaaaaacgcccattacgtggaaaagcgcctgggctcg
cgcgatatccagaccatgtatatcagcgacacctatcacgtattaaccctggacaaacgc
aaagacgacattgccaagcgcagcgccgagttttgccttgccctcgctcactga

DBGET integrated database retrieval system