KEGG   Methylovorus glucosetrophus: Msip34_1545Help
Entry
Msip34_1545       CDS       T00943                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mei  Methylovorus glucosetrophus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msip34_1545
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msip34_1545
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msip34_1545
Enzymes [BR:mei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msip34_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1655226..1656026)
Genome map
AA seq 266 aa AA seqDB search
MSRIKTTFDHLKQQGKKALIPYITAGDPHPDQTVKLLHAMVANGADMIELGVPFSDPMAD
GPVIQRASERALVHHVGLSRVLEIVREFRQQDNVTPIILMGYANPVEAMGQEKFSDRAKA
AGVDGVLTVDYPPEECKEFTALLQARGIDPIFLLSPTTEPARVEVIVNQASGFVYYVSLK
GVTGAKNLDIEEVAQKVAEIRTLTDLPVGVGFGVRDAATATAVAAIGDAVVVGSRMVQAV
EQSNDQNLVDNVAALMKELRIAVDAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcataaaaaccacgttcgatcacctcaagcagcagggaaagaaagcactgatc
ccttacattaccgctggtgaccctcatcctgaccaaaccgtaaagctgttacatgccatg
gtggcaaacggtgccgatatgattgagctcggcgtgcctttttcagatccgatggcagat
ggtcctgttattcagcgtgccagcgagcgtgcgctggtccatcacgttggcctgagccgc
gtgcttgaaatcgtgcgtgaattccgtcagcaggataatgtgacgcctatcatactgatg
ggttacgctaatccggttgaagcaatggggcaggagaagttttctgatcgagccaaagcc
gccggtgtggatggtgtactgacggtggattatccgcctgaggaatgcaaggaattcacc
gccctgttgcaggcacgcggtattgaccccatttttctgttatcaccgaccaccgagcct
gctcgtgtagaggtgattgtgaaccaggccagcggcttcgtttactatgtctccctcaag
ggggtgacgggtgccaaaaacctcgatattgaagaggtggcgcaaaaagtggctgaaatt
cgaaccctgacggatttgcctgtaggcgtgggttttggtgtgcgtgatgcggcgacagca
acggctgtggctgcgattggtgatgctgtggtggtgggcagccgtatggtgcaggctgtg
gaacaatccaatgatcaaaatctcgttgataacgtggctgcgctgatgaaagaattgcgc
atcgcggttgacgctgcttaa

DBGET integrated database retrieval system