KEGG   Methylovorus glucosetrophus: Msip34_1577Help
Entry
Msip34_1577       CDS       T00943                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00010  Glycolysis / Gluconeogenesis
mei00620  Pyruvate metabolism
mei00640  Propanoate metabolism
mei00680  Methane metabolism
mei01100  Metabolic pathways
mei01110  Biosynthesis of secondary metabolites
mei01120  Microbial metabolism in diverse environments
mei01130  Biosynthesis of antibiotics
mei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msip34_1577
   00620 Pyruvate metabolism
    Msip34_1577
   00640 Propanoate metabolism
    Msip34_1577
  Energy metabolism
   00680 Methane metabolism
    Msip34_1577
Enzymes [BR:mei01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msip34_1577
Lipid biosynthesis proteins [BR:mei01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msip34_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACT50822
JGI: Msip34_1577
UniProt: C6XE47
Position
1688057..1690018
Genome map
AA seq 653 aa AA seqDB search
MSSIETVLTETRVFPPQEAFKQAATISGLEQYTALCQQAEQDYPGFWAALAQKELDWHKP
FTAVLDEANAPFYRWFHDGELNASYNCLDRHLSNRGDKAALIFEADDGTVTTVSYRQLHQ
RVCRFANALKKQGVGKGDRVIIYLPMSVEAIVAMQACARIGAIHSVVFGGFSSKSLHERI
TDVGAKLVITSDGQMRGGRAMPLKPAVDEALSFGGCEAVTSVIVYKRTGGDVTWNARDLW
WHDLESAESDYCEPTWVNAEHPLFILYTSGSTGKPKGVQHSTGGYLLGAVMSMKWVFDHK
ATDIFWCTADVGWITGHSYVAYGPLALGSTQVVFEGVPTYPDAGRFWQMIEKHKVSVFYT
APTAIRSLIKLGGDLPNNYDLSSLRLLGTVGEPINPEAWMWYHKTVGRERCPIVDTWWQT
ETGAHMIAPLPGAINAKPGSCTRPLPGIMMDIVNEDGSHIDGTGGGLLVVKKPWPSMIRT
IWNDPERFKKSYFPEELKGVYLAGDSAHRDDDGYFWIMGRIDDVLNVSGHRLGTMEIESA
LVAHSLVAEAAVVGKPHEIKGESIVAYVVLKGARPEGDEAKQVVAQLRDWVGKEIGPIAK
PDEIRFGDNLPKTRSGKIMRRLLRSLAKGEEITSDISTLDNPAILEQLKQAVS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgattgaaaccgttctgaccgaaacccgcgttttccccccacaggaggccttc
aagcaggcagccaccatttcaggtctggaacaatacaccgcgctttgccagcaggccgag
caggattaccccggcttctgggctgcgctcgcgcaaaaggagctggattggcacaagcca
ttcaccgccgtgctggatgaagccaatgcgcctttttaccgctggtttcacgatggcgaa
ctgaatgcctcctacaactgcctagaccgtcatctttccaaccgcggcgacaaagctgcc
ctgattttcgaagccgacgacggcacggtcaccaccgtctcctatcgccagttgcaccag
cgcgtttgccgctttgccaatgccctgaaaaaacagggcgtcggcaaaggtgatcgcgtg
atcatctatctgcccatgagcgtggaagccattgtcgccatgcaggcctgtgcccgtatc
ggcgccattcactccgtggtgtttggcggcttctcatccaagagcctgcacgagcgcatc
accgatgtcggtgccaagctggtgatcacctccgatggccagatgcgtggcggccgcgcc
atgccgctgaaaccggccgtggacgaagccttgagctttggcggttgcgaagccgtgacc
agcgtgattgtgtacaagcgcaccggcggcgatgtcacctggaatgcgcgtgacttgtgg
tggcatgatctggaaagcgcagaatccgactactgcgagccaacctgggtcaatgcagag
catccgctgttcattctctatacctcaggctccaccggcaaacccaaaggcgtgcagcat
tccactggcggctatctgctgggtgcggtcatgagcatgaaatgggtattcgaccataaa
gccacggatattttctggtgcacggccgatgtgggctggattaccggccacagctatgtc
gcctatggcccgctggcgctgggcagcacgcaagtcgtgtttgaaggcgtgccgacctac
cccgatgccggccgtttctggcagatgatcgaaaagcacaaggtcagcgtgttttacact
gcgcccacggcaattcgctccctgatcaagctgggcggcgatttacccaataattacgat
ctttccagcctgcgcctgttgggcacggtgggcgagcccatcaaccctgaggcctggatg
tggtatcacaaaaccgtgggccgcgagcgctgcccgattgtggatacctggtggcaaacc
gaaaccggcgcacacatgattgccccgctgcccggcgccatcaatgcaaaacccggctcc
tgcacccgtcccctgcccggcatcatgatggatatcgtcaatgaagatggcagccatatt
gatggcaccggcggtggtctgctggtagtgaagaagccatggccatccatgatacgtacc
atctggaatgacccggagcgcttcaagaaatcgtatttccccgaagagctgaaaggcgtt
tacctcgccggtgactcagcccaccgtgacgatgatggctatttctggatcatgggccgc
attgacgatgtgctgaatgtttccggtcaccgcctcggcaccatggaaattgaatccgcg
ctggtagcccattcgctggtggcggaggctgccgtggttggcaagccgcatgagatcaag
ggcgaatccatcgtcgcttacgtagtgctgaaaggcgcccgtccggaaggcgatgaggcc
aagcaggtcgtggcgcagctgcgtgactgggtcggcaaggaaatcggccccatcgccaag
cccgatgaaatccgctttggcgataatctgcccaagacccgctccggcaagatcatgcgc
cgcctgctgcgctcgctggccaagggcgaggaaatcacctccgatatttccacgctggat
aatccggccattctggaacagctgaagcaggctgtttcctga

DBGET integrated database retrieval system