KEGG   Methylovorus glucosetrophus SIP3-4: Msip34_1602Help
Entry
Msip34_1602       CDS       T00943                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mei  Methylovorus glucosetrophus SIP3-4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mei00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mei00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1715801..1716331)
Genome map
AA seq 176 aa AA seqDB search
MKYLVAILLWVATNMAYAGGCNELYNHQFNTLQGEKINLCDYQDKPILVVNTASKCGFTP
QFEKLESMYKHYKSRGLLIIGFPSNDFKQELSSNKEIGDFCKQTYAVQFPMVGKTSVVGP
QAHLFYKQLAAITKEPPMWNFYKYLILPNGEQVYAYSSDVEPEASQIMTKLKPYLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctagtggcaattttattgtgggtggcgaccaatatggcatatgcaggaggg
tgtaacgagctttacaaccatcaattcaataccttgcagggcgagaagatcaacctttgc
gactatcaggacaagcccattctggtggtcaacaccgccagcaaatgtggtttcacgccg
cagtttgaaaagctggagtccatgtacaagcattacaaatcacgtggtttgctgatcatt
ggctttccttccaatgacttcaagcaggagttgagcagcaacaaggagataggtgacttt
tgcaagcagacctatgccgtgcaattccccatggtaggcaagacttctgtggtggggccg
caagcgcatcttttctacaagcagttggcggcgatcaccaaagagccccccatgtggaat
ttttacaaatacctgatcttgcccaatggcgagcaggtgtatgcctacagcagtgatgtt
gagcctgaggccagccagatcatgaccaagctgaagccttatctgaaataa

DBGET integrated database retrieval system