KEGG   Methylovorus glucosetrophus: Msip34_1677Help
Entry
Msip34_1677       CDS       T00943                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mei  Methylovorus glucosetrophus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mei00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Msip34_1677 (recR)
DNA repair and recombination proteins [BR:mei03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Msip34_1677 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1774520..1775119
Genome map
AA seq 199 aa AA seqDB search
MRNPPALEQLVESLRCLPGVGPKSALRMAYHLLQRDRSGANGLAQALHNALQVVTHCSLC
NTFSEDIVCPLCAADNRDPTLLCVVEMPTDLMMLEQTRVFQGRYFVLMGKLSPLDGIGPK
EIHLEKLLKRAQDGVVEEVVLATNYTVEGEATAHYISELLRSRGLKVSRIARGLPMGGEI
EHVDSGTLAQALMERRSVR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatccgcccgcactggagcagcttgttgagtccctgcgctgccttccaggcgta
ggccccaagtccgcattgcgcatggcctatcaccttttgcagcgtgatcgtagcggtgcc
aatggcctcgcccaggcgctgcacaatgcattgcaagtcgtcacccattgcagcttgtgc
aacaccttcagcgaagatatcgtctgccctctatgcgcagcggataaccgcgaccccact
ttgctctgcgtggttgaaatgcccacggatctgatgatgctggagcagacgcgcgtgttt
cagggccgctactttgtattgatgggcaaactgtccccgctcgatggcataggccccaaa
gaaattcatctggaaaaactgctgaaacgtgcgcaggatggcgtggtagaagaagtggtg
ctcgccaccaattacaccgtggaaggcgaagcgacggcgcactacatcagcgagctgtta
cgctcgcgtggcctcaaggtgagccgcatcgcacgaggcttgcctatgggcggcgaaatt
gagcatgtggatagcggaacactggcgcaggccctgatggagcggcgcagcgttcgctaa

DBGET integrated database retrieval system